KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_02112Help
Entry
ESA_02112         CDS       T00586                                 

Gene name
btuE
Definition
putative glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:esa00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:esa00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2064574..2065125)
Genome map
AA seq 183 aa AA seqDB search
MQHDILNTEVTTIDGETISLEQYKGKVLLIVNVASKCGLTPQYEQLENIHKAWEPSGFRV
LGFPCNQFLGQEPGSEDEIKTFCSTTYGVTFPMFSKIDVNGDNRHPLYQKLIAAAPKAVA
PEQSGFYERMASKGRAPLYPDDILWNFEKFLVGRDGQVIQRFSPDMTPEDPIVMEAIKLA
LAK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcaacacgacattctgaataccgaagtgaccaccattgacggtgaaaccatttcgctt
gagcagtacaaaggcaaagtgctgttgatcgttaacgtcgcctcaaagtgcgggctgacg
cctcagtatgagcagctggaaaatattcataaagcctgggagccgtccggctttcgcgta
ctgggcttcccgtgcaaccagtttctgggccaggagccgggcagcgaagacgagatcaaa
acgttctgcagcaccacttacggcgtgacgttccccatgttcagcaaaatcgacgtcaac
ggcgacaaccggcacccgctgtatcagaagctcatcgccgccgcgccgaaagctgtcgcg
ccggagcaaagcggtttttatgagcgtatggcgagtaaaggccgcgcgccgctctacccg
gacgacatcctctggaactttgaaaaattcctcgtgggtcgcgacggtcaggtgatccag
cgcttctcaccggatatgacgccggaagatccgatcgtgatggaagccattaagctggcg
ctggcgaagtaa

DBGET integrated database retrieval system