KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_02134Help
Entry
ESA_02134         CDS       T00586                                 

Definition
6-phosphofructokinase 2
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:esa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ESA_02134
   01230 Biosynthesis of amino acids
    ESA_02134
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ESA_02134
   00030 Pentose phosphate pathway
    ESA_02134
   00051 Fructose and mannose metabolism
    ESA_02134
   00052 Galactose metabolism
    ESA_02134
  Energy metabolism
   00680 Methane metabolism
    ESA_02134
Enzymes [BR:esa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ESA_02134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2081983..2082912
Genome map
AA seq 309 aa AA seqDB search
MVRIYTLTLAPSLDSATITPQIYPEGKLRCSAPVFEPGGGGINVARAIVHLGGSATALFP
AGGATGEHLVSLLNDEKVAVETVSARDWTRQNLHVHVESSGEQYRFVMPGATITDDEFRQ
LEEKVLTIESGAILVISGSLPPGVSVEKLQQLIKAARAQGIRLIVDSSGDALAAALEVGD
IELVKPNQKELAALVKRDLTAPDDVRKAAEELVQKGKARRVVVSLGPQGALGVDGKDCVQ
VVPPPMKSQSTVGAGDSMVGAMTLRLSQDAPLLDMVRYGVAAGSAATINQGTRLCSLENT
ESIYHWLTR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtatttatacgctcacgctggcgccctcgctcgacagcgccacaatcacgccg
caaatctatccggaagggaaactacgctgcagcgcgccggtgtttgaacccggcggcggc
ggtattaacgtcgcacgcgctatcgtccatctgggcggcagcgccacggccctcttcccg
gcgggtggcgcgacaggcgagcatctggtctcgctgcttaatgatgaaaaggtcgcggtc
gagacggtttccgcccgcgactggactcgccagaatcttcacgtgcatgtcgaatcgagt
ggcgagcaataccgcttcgttatgccaggcgccacgattaccgacgatgaattccgccag
ctggaagaaaaagtgctgacgattgaatcgggcgcaatcctggtcatcagcggcagcctg
ccgcccggtgtcagcgtggagaaactccagcaactgattaaagcggcacgtgcgcaaggg
attcgcctgattgtcgacagctccggcgacgcgctggccgccgcgctggaagttggcgat
atcgaactggttaaacccaatcagaaagagctggcggcgctggtgaaacgcgatctgacc
gcgccggacgatgtccgtaaagccgcagaagaactggtgcaaaaagggaaggcccgccgc
gttgtggtttcactggggccgcagggcgcgctcggcgttgacggtaaagactgcgtgcag
gtcgtgccgccgccgatgaaaagccagagtaccgtcggtgcgggcgacagcatggtcggt
gctatgacgctgcgcttatcccaggatgccccgctgctggatatggtgcgttatggtgtg
gctgccggcagcgccgctactatcaatcagggtacgcgcctctgctcgctggagaatacc
gagagtatttaccactggctgacacgctaa

DBGET integrated database retrieval system