KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_02134Help
Entry
ESA_02134         CDS       T00586                                 

Definition
6-phosphofructokinase 2
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:esa01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:esa01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:esa00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:esa00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:esa00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:esa00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:esa00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2081983..2082912
Genome map
AA seq 309 aa AA seqDB search
MVRIYTLTLAPSLDSATITPQIYPEGKLRCSAPVFEPGGGGINVARAIVHLGGSATALFP
AGGATGEHLVSLLNDEKVAVETVSARDWTRQNLHVHVESSGEQYRFVMPGATITDDEFRQ
LEEKVLTIESGAILVISGSLPPGVSVEKLQQLIKAARAQGIRLIVDSSGDALAAALEVGD
IELVKPNQKELAALVKRDLTAPDDVRKAAEELVQKGKARRVVVSLGPQGALGVDGKDCVQ
VVPPPMKSQSTVGAGDSMVGAMTLRLSQDAPLLDMVRYGVAAGSAATINQGTRLCSLENT
ESIYHWLTR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtatttatacgctcacgctggcgccctcgctcgacagcgccacaatcacgccg
caaatctatccggaagggaaactacgctgcagcgcgccggtgtttgaacccggcggcggc
ggtattaacgtcgcacgcgctatcgtccatctgggcggcagcgccacggccctcttcccg
gcgggtggcgcgacaggcgagcatctggtctcgctgcttaatgatgaaaaggtcgcggtc
gagacggtttccgcccgcgactggactcgccagaatcttcacgtgcatgtcgaatcgagt
ggcgagcaataccgcttcgttatgccaggcgccacgattaccgacgatgaattccgccag
ctggaagaaaaagtgctgacgattgaatcgggcgcaatcctggtcatcagcggcagcctg
ccgcccggtgtcagcgtggagaaactccagcaactgattaaagcggcacgtgcgcaaggg
attcgcctgattgtcgacagctccggcgacgcgctggccgccgcgctggaagttggcgat
atcgaactggttaaacccaatcagaaagagctggcggcgctggtgaaacgcgatctgacc
gcgccggacgatgtccgtaaagccgcagaagaactggtgcaaaaagggaaggcccgccgc
gttgtggtttcactggggccgcagggcgcgctcggcgttgacggtaaagactgcgtgcag
gtcgtgccgccgccgatgaaaagccagagtaccgtcggtgcgggcgacagcatggtcggt
gctatgacgctgcgcttatcccaggatgccccgctgctggatatggtgcgttatggtgtg
gctgccggcagcgccgctactatcaatcagggtacgcgcctctgctcgctggagaatacc
gagagtatttaccactggctgacacgctaa

DBGET integrated database retrieval system