KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_02237Help
Entry
ESA_02237         CDS       T00586                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:esa00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:esa00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2174276..2175301)
Genome map
AA seq 341 aa AA seqDB search
MGPVMLDVEGFELDAEEREILAHPLVGGLILFTRNYHDPEQLRELVRQIRSSARNHLVIA
VDQEGGRVQRFREGFTRLPAAQSFAALLGMDAGGKLAEEAGWLMACEMIAMDIDISFAPV
LDVGHLSAAIGERSFHEEPENVLAMAKRFITGMQSAGMKATGKHFPGHGAVSADSHKETP
RDPRPAAEIRRHDMLPFRELISYNMLDAVMPAHVVYSDVDPLPASGSPYWLKQVLRKELG
FDGVIFSDDLSMEGAAILGSYAERGQAALDAGCDMILVCNNRKGAVSVLDNLSPIKAERV
TRLYHKGVITRQELMASARWKQVSGELTALHERWQTHKAGQ
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgggtccggtcatgctggatgtggaaggctttgagcttgatgccgaagagcgtgaaatc
ctcgcgcatccgttggtgggagggcttatcctctttacccgcaactatcacgatccagag
caactgcgtgaactggtccgccagatccgctcaagcgcccgcaatcatctggtgattgcc
gtagaccaggagggcggacgcgtacagcgttttcgcgagggctttacgcgtctgccagcg
gcacaaagtttcgccgcgctgctgggaatggacgccggtggcaaactggcggaagaagcc
ggctggctgatggcgtgtgaaatgatcgcgatggatatcgatatcagctttgcgccggtg
ctggatgtcgggcatctcagcgccgcgattggcgagcgttccttccacgaagagcctgaa
aacgtgctggcgatggcgaagcgtttcattaccggcatgcagagcgcgggaatgaaagcg
acgggcaaacacttccccggtcacggtgccgtcagcgccgattcccataaagagacgccg
cgcgacccgcgtccggccgcggaaatccgccgccacgatatgctgccgtttcgcgagctg
attagttacaacatgcttgatgcggtgatgccggcacacgtcgtctatagcgacgtcgat
ccgctgccagccagcggttcgccttactggcttaagcaggtgctgcgcaaggagctcggt
tttgacggcgtgattttctcagacgatctgtcgatggaaggcgcggctatcctcggaagc
tacgcggagcgcggccaggcggcgctggatgccggttgcgatatgatccttgtctgtaat
aatcgtaagggtgccgtaagcgttcttgataacctgtcaccgatcaaagcagagcgtgtt
acacgtttgtatcataaaggtgtaattacgcgtcaggaactgatggcgtcggcgcgctgg
aagcaggtaagcggggagcttaccgcgctgcatgagcgctggcagacgcacaaggcgggg
caataa

DBGET integrated database retrieval system