KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_02576Help
Entry
ESA_02576         CDS       T00586                                 

Definition
putative pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ESA_02576
   00500 Starch and sucrose metabolism
    ESA_02576
Enzymes [BR:esa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     ESA_02576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2530728..2531906
Genome map
AA seq 392 aa AA seqDB search
MLSADEAKNFAPARYFSNIDPNAAPWSPSPIRLPEKADFVVGQAGEQGVTHTSIQAAVDA
AIARHATARQYIAVLPGTYEGTVYVPAAPGSVTIYGTGEKPLDVKISAALDSEMDANTWR
RTVNPSGKYMPGKPAWYMFDNCQNRRNGSVGLMCSAVFWSQNNGLQLQNLTIENSLGDAA
GEGQHQGVALRTDGDRVQINKVNVLGRQNPFLVTNSDIRNRFTPDRLTRTQVTNSYVEGD
VDLVAGRGAVVFDNTEFRVVNTRTQKEGYVFAPATMPNFYYGFLAVNSRFVAAGEGVAQL
GRAWDMDAANGYTPGQTPNGQVVIRDSVIDAGFNTAQPWGPALGSQRPFTGNTGAQDDKG
NIQRDLNDANANRLWEYNNRGLGSKVVAEPKK
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtgctgtctgcggatgaagcgaaaaatttcgccccggcccgctatttctccaatatcgat
ccgaatgccgcgccgtggtcaccctccccgattcgactgcctgaaaaagcggacttcgtg
gtcggccaggcaggcgagcagggcgtgacccacaccagcattcaggccgccgttgacgcc
gcgattgcgcgtcacgcgacggcgcgtcagtacatcgctgtactccccggcacttacgaa
ggcaccgtttatgtgcctgcggcaccgggcagcgtgacgatttacggcaccggcgaaaaa
ccgctggatgtgaaaatcagcgccgcgctggacagcgaaatggatgccaacacctggcgt
cgtaccgtaaacccgtccggcaaatatatgcccggcaaaccggcctggtatatgttcgac
aactgccagaaccgccgcaacggcagcgtcggcctgatgtgctccgcggtgttctggtca
cagaataatggcctgcaactgcaaaacctgaccattgaaaacagcctcggcgacgccgcg
ggcgaaggtcagcaccagggtgtcgcgctgcgcaccgatggcgaccgcgtgcagatcaac
aaagtgaatgttctgggccgccagaatccgttcctggtgaccaacagcgatatccgcaac
cgcttcacgccagatcgtctgacccgcacgcaggtgacgaacagctacgtggaaggcgat
gtggatctggtcgcgggccgcggcgcggtggtgtttgataacaccgaattccgcgtagtg
aacacccgtacccagaaagaaggttatgtgtttgcgccagcgaccatgccgaacttctat
tacggcttcctcgccgtgaacagccgctttgtcgcggccggtgaaggcgtggcgcagctc
ggccgcgcatgggatatggacgccgccaatggctatacgcctggccagacgccaaacggc
caggtcgttatccgcgacagcgtgattgacgccggcttcaacaccgcgcagccgtggggc
ccggcgctgggctcacagcgtccgttcaccggcaacaccggcgcgcaggacgacaaaggc
aatatccagcgcgatctgaacgacgcgaacgccaaccgtctgtgggaatacaacaaccgc
gggctgggcagcaaagtggttgccgaaccgaaaaagtaa

DBGET integrated database retrieval system