KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_02590Help
Entry
ESA_02590         CDS       T00586                                 

Definition
(GenBank) hypothetical protein
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:esa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ESA_02590
   01230 Biosynthesis of amino acids
    ESA_02590
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ESA_02590
  Energy metabolism
   00680 Methane metabolism
    ESA_02590
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ESA_02590
Enzymes [BR:esa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ESA_02590
Exosome [BR:esa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ESA_02590
  Exosomal proteins of melanoma cells
   ESA_02590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2544032..2544784
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGVSEAKAAGKLLKDEGYSFDFAYTSVL
KRAIHTLWNILDGLDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPALTKDDERYPGHDPRYAKLSEQELPLTESLALTIDRVIPYWNETILPRLKSGERVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPIKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgttactaagctggttctggttcgtcacggcgaaagccagtggaacaacgaaaac
cgctttaccggttggtacgacgttgacctgtctgagaaaggcgtcagcgaagcgaaagcc
gcgggcaagctgctgaaagacgaaggctacagctttgactttgcttatacctccgtgctg
aaacgtgccatccacacgctgtggaacatcctggacgggctggatcaggcctggctgccg
gttgaaaaatcctggaaactgaacgagcgtcactacggcgcgctgcagggtctgaacaaa
gctgaaaccgctgaaaaatacggtgacgagcaggtgaaacagtggcgtcgcggcttcgcg
gtgactccgccggcgctgaccaaagatgacgagcgctacccgggccacgatccgcgttat
gcgaaactgagcgagcaggaactgccgctgactgagagcctggcgctgaccatcgatcgc
gttatcccttactggaacgaaaccattctgccgcgcctgaaaagcggtgagcgcgtaatt
atcgccgctcacggtaactccctgcgcgcgctggtgaaatacctggataacatgagcgaa
gaagagatccttgagctgaatatcccgaccggcgtgccgctggtgtatgagttcgacgaa
aacttcaaaccgattaagcactactatctgggtaacgctgacgagatcgcagcgaaagcg
gcggctgtcgcaaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system