KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_02620Help
Entry
ESA_02620         CDS       T00586                                 

Definition
(GenBank) hypothetical protein
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
esa00020  Citrate cycle (TCA cycle)
esa00640  Propanoate metabolism
esa00660  C5-Branched dibasic acid metabolism
esa01100  Metabolic pathways
esa01110  Biosynthesis of secondary metabolites
esa01120  Microbial metabolism in diverse environments
esa01130  Biosynthesis of antibiotics
esa01200  Carbon metabolism
Module
esa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
esa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:esa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ESA_02620
   00640 Propanoate metabolism
    ESA_02620
   00660 C5-Branched dibasic acid metabolism
    ESA_02620
Enzymes [BR:esa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     ESA_02620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ABU77860
UniProt: A7MQX5
Position
complement(2566880..2568046)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARSGLPTPVGYACSTPREAEEAASKIGSGPWVVKCQVHAGGRGKAGGV
KVVKSKEEIRAFAEHWLGKRLVTYQTDANGQPVNQILVEAATDIAKELYLGAVVDRGSRR
VVFMASTEGGVEIEKVAEETPHLIHKVAIDPLTGPMPYQGRELAFKLGLEGKLVQQFTKV
FMGLANIFLERDLALIEINPLVITSQGDLICLDGKLGADGNALFRQPDLREMRDQSQEDP
REAQAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGEPANFLDVGGGATKERVTE
AFKIILSDDKVKAVLVNIFGGIVRCDLIADGIIGAVAEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAAKSLTDAAQQVVAAVEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacacgaatatcaggcgaaacagctgtttgccagatcaggcctgccgacgccg
gtaggttatgcctgctcgactccgcgtgaagcagaagaagccgcctctaaaatcggctcc
ggcccgtgggtggtgaaatgccaggtacacgcaggcggccgcggtaaagcgggcggtgta
aaagtcgttaagagcaaagaagagattcgcgcctttgccgagcactggctgggcaaacgc
ctggtgacctatcaaacggacgcgaacggccagccggttaaccagatcctggtggaagcg
gcgaccgatatcgcgaaagaactctacctcggcgcggtggttgaccgtggctcccgtcgc
gtggtgttcatggcctctaccgaaggcggcgtggaaattgaaaaagtggcggaagaaacc
ccgcacctgatccacaaagtcgctatcgatccgctgaccggcccgatgccgtatcaggga
cgcgagctggccttcaaactgggccttgaagggaaactggttcagcagttcaccaaagtg
tttatgggtcttgcgaacattttcctggagcgcgacctggcgcttatcgaaatcaacccg
ctggttatcacctctcagggcgacctgatctgcctcgacggcaaactgggcgctgacggc
aacgcactgttccgccagccggatctgcgtgaaatgcgcgaccagtctcaggaagatccg
cgcgaagcgcaggcagcgcagtgggagctgaactacgtggcgctcgacggcaacatcggt
tgcatggtgaacggcgcgggcctcgcgatgggcactatggacatcgtgaagctgcacggc
ggcgaaccggctaacttcctggacgtgggcggcggcgcgaccaaagagcgcgtgaccgaa
gcgttcaaaatcattctgtctgacgacaaagtgaaagccgtactggttaacatcttcggc
ggtatcgtgcgctgcgacctgattgccgacggcatcatcggcgcggtggcggaagtgggc
gtgaacgttccggttgtcgtgcgtcttgaaggcaacaacgccgagctgggcgcgaagaaa
ctggccgacagcggcctgaatattattgcagcgaaaagtctgacggatgcagctcagcag
gttgttgctgctgtggaggggaaataa

DBGET integrated database retrieval system