KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_02621Help
Entry
ESA_02621         CDS       T00586                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:esa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ESA_02621
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ESA_02621
  Amino acid metabolism
   00310 Lysine degradation
    ESA_02621
Enzymes [BR:esa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ESA_02621
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2568157..2569380)
Genome map
AA seq 407 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDAVKRDEVLVEIETDKVVLEVPASADGVLDAV
LEDEGSTVTSRQILGRLREGNSAGKESSAKPEAKESTPAQRQQASLEEQNNDALSPAIRR
LLAEHNLDAAAIKGTGVGGRLTREDVEKHLAKANGSESAKAPEQAAAAPQPQLGSRSEKR
VPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGDAFEKRHGIRLGFMSFY
VKAVVEALKRFPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDVLGMADIEKK
IKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAV
DGKVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLLDV
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattcttgttcccgacctgcctgaatccgttgctgacgcaaccgtc
gccacctggcataaaaagccgggcgacgcggtgaaacgcgatgaagtgctggtagaaatc
gaaactgacaaagtggtactggaagtaccggcgtcggctgacggcgttctggatgcggta
ctggaagacgaaggcagcaccgtcacctctcgccagatcctgggccgcctgcgcgaaggc
aacagcgcgggcaaagagagcagcgccaaaccggaagcgaaagaatctaccccggcgcag
cgccagcaggcgtctctcgaagaacaaaataacgacgcgctgagcccggctatccgccgt
ctgctcgccgaacacaacctggacgcggccgccatcaaaggcaccggcgtcggtggccgt
ctgacccgtgaagatgtggaaaaacatctggcgaaagcgaacggcagcgaatctgccaaa
gcgccggaacaagccgccgccgcgccgcagccgcagctcggttcccgcagcgaaaaacgc
gtaccgatgacccgcctgcgcaaacgcgtggccgagcgtctgctggaagcgaaaaactcc
accgcgatgctgaccacgttcaacgaagtgaacatgaagccgattatggatctgcgtaag
cagtacggcgacgccttcgaaaaacgtcacggtatccgtctgggctttatgtccttctac
gtgaaagcggtcgttgaagcgctcaaacgcttcccggaagtgaacgcctccatcgatggc
gacgacgtggtgtatcacaactatttcgacgtcagcatggcggtctctacgccgcgcggc
ctggtgaccccggttctgcgtgatgtggacgtgctgggcatggcggacatcgagaagaaa
atcaaagagctggcggtcaaaggccgtgacggcaaactgaccgtggaagatctgaccggc
ggtaacttcaccattaccaacggcggcgttttcggctcgctgatgtccacgcctatcatc
aacccgccgcagagcgcgatcctcggcatgcatgccattaaagatcgtccgatggcggtg
gacggcaaggttgagatcctgccgatgatgtacctggcgctctcctacgatcaccgtctg
atcgacggccgtgaatcggtaggtttcctggtgaccattaaagagttgctggaagatccg
actcgtctgctgctggacgtgtag

DBGET integrated database retrieval system