KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_02625Help
Entry
ESA_02625         CDS       T00586                                 

Gene name
sdhD
Definition
succinate dehydrogenase cytochrome b556 small membrane subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:esa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ESA_02625 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ESA_02625 (sdhD)
   00650 Butanoate metabolism
    ESA_02625 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    ESA_02625 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2575144..2575491)
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATSIVMTLYIIYMIGFFAMNGDLTYEVWTGFFSSTFTKVF
TLLTLISILVHTWIGMWQVLTDYVKHLALRLFLQLAIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaacggcgtacatgacttcatcctggttcgc
gccacctccatcgtaatgacgctgtatatcatttatatgatcggtttcttcgcgatgaac
ggcgacctgacatatgaagtctggactggtttcttctcatccaccttcaccaaagtgttc
accctgctgaccctgatttccattctcgtccatacctggattgggatgtggcaggtgctg
accgactacgtaaaacatctggcgctgcgtctgtttttgcagctcgcgattgttgtcgcg
ctggtggtttacgtgatttatggatttgttgtggtgtggggtgtgtaa

DBGET integrated database retrieval system