KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_02747Help
Entry
ESA_02747         CDS       T00586                                 

Definition
hypothetical protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Brite
Enzymes [BR:esa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     ESA_02747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2698300..2698803)
Genome map
AA seq 167 aa AA seqDB search
MAIPSSLRNKLIAAAGAGSMVIATIFIGGKDGVEGRKYQAYKDVAGVWTVCDGHTGNDII
RGKTYTDKECDRLLWKDLQPAKATVDKLVKVPLSEYQRASLYSFVFNVGSDAFAKSTLLR
KLNKGDQEGACEEMRRWVYAGGMKWKGLQNRREMERSMCLAESENDL
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggctatcccgtcctcactgagaaacaaactgattgccgcagcgggtgcaggctcgatg
gtcatcgccacgatattcatcggtggcaaggatggcgtagagggccggaagtatcaggcc
tacaaagatgtcgcaggcgtctggactgtctgcgacggtcacactggcaacgacatcatt
cgcgggaagacctacacagacaaagaatgtgaccgtcttttgtggaaagacctgcaaccg
gccaaggcgaccgtagacaagctggttaaggttcctctgagcgaataccagcgcgcctcg
ctctacagcttcgtgttcaacgtaggcagtgatgccttcgctaagtcgacgcttcttcgc
aagctgaacaaaggcgaccaggaaggggcgtgtgaagaaatgcgccgctgggtctatgca
ggcggtatgaagtggaagggattgcagaaccggcgggagatggagcgctctatgtgcctg
gcggaaagtgaaaatgacctttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system