KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_02772Help
Entry
ESA_02772         CDS       T00586                                 

Definition
multifunctional acyl-CoA thioesterase I and protease I and lysophospholipase L1
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:esa00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    ESA_02772
Enzymes [BR:esa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     ESA_02772
   3.1.2  Thioester hydrolases
    3.1.2.-  
     ESA_02772
Lipid biosynthesis proteins [BR:esa01004]
 Fatty acid synthase
  Component type
   ESA_02772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2717653..2718312
Genome map
AA seq 219 aa AA seqDB search
MFPLTDGFIKMMNFKNVFRWHFPFLLLALLSFRAAAADTLLVLGDSLSAGYRMAADAAWP
ALLNDKWQQRDVRVVNASISGDTAQQGLSRLPALLKQHQPRWVLIELGGNDGLRGFPPDT
LSATLRKIIEQVKTAGAEPLLMQIRLPANYGRRYNQAFEAIYPELAQSFSIPLLPFFMEE
VYLKPQWMQDDGIHPNRDAQPFIADWMAQRLAPLVKHDS
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
gtgttccccctgaccgacggatttattaagatgatgaacttcaagaatgttttccgctgg
catttccctttcctgttactggcgttattaagctttcgcgccgccgcggcggacacgtta
ctggtgctgggcgacagcctgagcgcgggctatcgtatggcggcggacgccgcatggcct
gcgctgctgaacgataaatggcagcagcgcgacgtgcgcgtggtcaacgcgagcatcagc
ggcgacaccgctcagcaggggctttcgcgcctgcctgcgctgcttaaacagcatcagccg
cgctgggtgctgattgagcttggcggcaacgacggtctgcgcggttttccgccggatacg
ctttccgccacgctcaggaaaatcatagaacaggttaaaaccgcgggcgcggagccgctg
ctgatgcagatccgcctgccagcgaactacggacgccgctacaatcaggcgtttgaagcg
atttacccggaactggcgcaatctttttccatccccctgctgcccttttttatggaagag
gtttacctcaaaccgcagtggatgcaggacgatggcattcatcccaatcgcgacgcccag
ccgtttattgccgactggatggcgcagcgactggcccctttagttaaacacgactcataa

DBGET integrated database retrieval system