KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_02936Help
Entry
ESA_02936         CDS       T00586                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:esa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ESA_02936
Enzymes [BR:esa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     ESA_02936
Exosome [BR:esa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ESA_02936
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2890533..2891447
Genome map
AA seq 304 aa AA seqDB search
MFEETSLSRNDLVLPIFVEEELDDYKPIAAMPGVMRIPERYLAREIERIAKAGIRSVMTF
GISHHTDECGSDTWNENGLVARMSRIAKDAVPEMVVMSDTCFCEYTSHGHCGVLCEHGVD
NDATLVNLGRQAVVAAAAGADFIAPSAAMDGQVKAIRQALDAAGFTDTAIFSYSTKFASS
FYGPFREAAGTALKGDRKTYQMSPMNRREAIRESLLDEAEGADALMVKPAGAYLDILRDV
RERTSLPLGAYQVSGEYAMIKFAAQAGAIDEEKVILESLGAIKRAGADLIFSYFALDLAE
KNIL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaagaaacctcgttaagccgcaacgatctggtactgccgattttcgttgaggaa
gagctggacgactacaaaccgatcgccgccatgccgggcgtaatgcgcatcccggaaaga
tacctcgcccgtgaaattgagcgtattgcgaaagcgggcatccgctccgtgatgaccttc
gggatttcgcaccacaccgatgagtgcggtagcgacacctggaatgaaaacggtctggtg
gcgcgtatgtcgcgtatcgccaaagacgccgtgccggaaatggtcgtgatgtctgacacc
tgcttttgcgaatataccagccacggccactgcggcgtgctgtgcgaacacggcgtggac
aacgacgcgaccctggtcaacctgggccgtcaggcagtggttgctgccgctgcaggtgcc
gattttatcgcgccttccgccgcgatggacggccaggtgaaagccatccgtcaggcgctc
gacgccgcgggcttcacggatacggctatcttctcctactccacaaaattcgcgtcgtcg
ttctacggcccgttccgcgaagcggcgggcaccgcgctgaaaggcgatcgtaaaacttat
cagatgagcccgatgaaccgccgcgaagcgatccgcgaatcgctgctggatgaagccgaa
ggcgcggacgcgctgatggtcaaaccggcgggcgcttatctcgacatcctgcgcgacgtg
cgcgagcgcaccagcctgccgcttggcgcttatcaggtgagcggcgaatacgcgatgatc
aaattcgccgcccaggcgggcgcgattgacgaagagaaagtgatcctggaaagcctcggc
gctatcaagcgcgcgggcgcggatcttatcttcagctacttcgcgctcgatctggccgag
aaaaacatcctctga

DBGET integrated database retrieval system