KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_02977Help
Entry
ESA_02977         CDS       T00586                                 

Gene name
lacZ
Definition
beta-D-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ESA_02977 (lacZ)
  Lipid metabolism
   00600 Sphingolipid metabolism
    ESA_02977 (lacZ)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    ESA_02977 (lacZ)
Enzymes [BR:esa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     ESA_02977 (lacZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2934634..2937765)
Genome map
AA seq 1043 aa AA seqDB search
MTENPTTTAFNELQTRPLATILARNDWQNPAITSVNRLPSHTPLHGWRDADRARRGEPSD
AVLSLDGEWQFSFFASPHQVPEVWLAADLSDARATPVPSNWQMEGYDTPIYTNVRYPIPV
NPPFVPDDNPTGCYSRDIEVPQAWLETGRTRIIFGGVNSAFYLWCNGQWVGYSQDSRLPA
EFDLTGVLHAGRNRLCVLVLRWSDGTYLEDQDMWRMSGIFRPVSLLHLPEQALADVRVHT
ELAPSLRHATLFSEVEVTPAACGLSVTLALWHGENEIASQTLPLGSAPIDERGNYAERVT
LSLDVDNPLLWSAETPHLYRAVVTLLDADGMPLVSEAHDVGFRRVEINNGLLTLNGQPLL
IRGVNRHEHHPEKGQAVDEAAMVQDILLMKQNNFNAVRCSHYPNQPRWYELCSRYGLYVV
DEANIETHGMEPMSRLSDDPVWLGAYSERVTRMVKCNRNHPSIIIWSLGNESGNGATHTA
LYNWIKHQDPTRPVQYEGGGADTRATDIICPMYARVETDQLIPAVPKWSIKKWISMPGET
RPLILCEYAHAMGNSLGNFADYWAAFRQYPRLQGGFIWDWADQAITRVEPDGSRWWAYGG
DFGDTPNDRQFCMNGLVFPDRTPHPALFEAKHQQQFFQFRLVSENPLQIEVTSEYLFRES
DNERLLWSIEVRGETRLSGELTLELGPQASRVLTLSDTGFSARAGDEEIWLHVRVEQPQA
TPWSPEGHLSAWAQWPLAAPLALPEPVAAGDAPQLEITDAEFVIRHGCQTWRVSRASGQL
IQWSDDGVDQILTPLADQFIRAPIDNDIGVSEVERIDPNAWVERWKAAGLYNTEHRCLAC
DAQTTRDGVEIVAQHAYFVKGVADGPAILSRWRMVVDNQGALHCDIDIARSAALPPLPRV
GVVCQLRGGEETASWLGLGPHENYPDRLSSACFSRWTLPLSELTTPYIFPGENGLRCNTR
ELNWNGWQAEGEFHFSLSPYGTRQLMETSHWHKLQPEAGIWLTIDGFHMGVGGDDSWTPS
VHPEYLLTAREYRYRFTLRRRQG
NT seq 3132 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaaaccccaccacgaccgcttttaacgaacttcagacgcgcccgctggcgacg
atccttgcccgcaacgactggcagaacccggcgatcaccagcgttaaccgtctgccgtcc
catacgccgctgcacggctggcgcgacgccgatcgggcgcgccggggagagccatccgac
gccgtgctgtcgctcgacggcgaatggcagttcagctttttcgccagccctcaccaggtg
ccggaagtctggctggcggcggatctcagcgacgcccgcgccacgccggtgccgtcaaac
tggcagatggaaggctacgacacgccgatctacaccaacgtgcgctacccgatcccggtg
aatccgccgtttgtgccggacgacaacccgacaggctgctattcgcgcgatatcgaggtg
ccgcaggcgtggctggagacgggccgcacgcgcattatctttggcggcgtgaattcggcg
ttttatctctggtgtaacggtcagtgggtgggctattcgcaggacagccgcctgccggcg
gaattcgatcttaccggcgtgctgcacgcgggccgcaaccgcctgtgcgtgctggtgctg
cgctggtcggacggcacttatctggaagatcaggatatgtggcgcatgagcggcattttc
cgcccggtcagcctgctgcatctcccggagcaggcgctggccgatgtgcgcgtgcatacc
gagcttgcgccgtcgctgcgtcacgccacgctgttcagcgaggtggaagtgacgcccgct
gcgtgcgggcttagcgtgacactcgcgctgtggcacggcgaaaacgaaatcgcgagccag
acgctgccgctcggctccgccccgattgatgagcgtggcaactacgccgagcgcgtcacg
ctctcgcttgacgttgacaacccgctgctgtggagcgccgaaacgccgcatctgtatcgc
gcggtggtgacgctgctggatgccgacggcatgccgctggtctctgaggcgcacgacgtc
ggctttcgtcgcgtggaaatcaacaacggcctgctgacgctcaacggccagccgctgctg
atccgcggcgttaaccgtcacgagcatcacccggaaaaaggccaggcggtggacgaggcg
gcgatggtgcaggacatcctgctgatgaagcagaacaacttcaacgccgtgcgctgttcg
cactaccccaaccagccgcgctggtatgaactgtgcagccgctacgggctgtacgtggtg
gacgaagccaatatcgaaacccacggcatggagccgatgagccgtctttcggacgatccg
gtgtggcttggcgcgtacagcgagcgcgtcacgcgcatggtgaaatgcaaccgtaaccac
ccgagcattattatctggtcgctcggcaatgagtctggcaacggcgcgacccacaccgcg
ctctataactggatcaagcatcaggacccgacgcgcccggtgcagtatgaaggtggcggg
gcggatacccgcgcgaccgacatcatctgcccgatgtacgcgcgcgtggagaccgaccag
ctgattcctgcggtgccgaaatggtcgatcaaaaagtggatttcaatgcctggcgaaacc
cgcccgctgatcctttgtgaatacgcccacgcgatgggcaacagcctggggaatttcgct
gattactgggccgcgttccgccagtatccgcgcctgcagggcggctttatctgggactgg
gccgaccaggccattacgcgcgtcgagcctgacggcagccgctggtgggcctacggcggc
gatttcggcgacacgccgaacgaccgtcagttctgcatgaacgggctggtctttccggac
cgcacgccgcacccggcgctctttgaggcgaagcatcagcagcagttcttccagttccgt
ctggtgagtgaaaacccgctgcaaatcgaggtgaccagcgaatacctgttccgcgagagc
gacaacgagcgcctgctgtggagcatcgaggtgcgcggcgagacgcgcctgagcggggaa
ctgacgctggagctcggcccgcaggcgtcccgcgtgctgacgctcagcgacacaggcttt
agcgcccgcgcgggcgacgaggaaatctggctgcatgtgcgcgttgaacagccgcaggcg
acgccgtggtcgccggaagggcatctcagcgcctgggcgcaatggccgctcgccgcaccg
ctcgcgctgccggagccggttgcggcaggcgacgcgccgcagcttgagatcaccgacgcg
gaatttgtcattcgccacgggtgtcagacctggcgcgtgagccgcgccagcggtcaactg
atacagtggagcgacgacggcgtggatcagatcctgacgccgcttgccgatcagttcatc
cgcgcgccgatcgataacgatatcggcgtcagcgaagtggaacgcatcgatccgaacgcc
tgggtggagcgctggaaagccgccgggctgtataacaccgaacaccgctgcctggcctgc
gacgcgcagaccacccgcgacggcgtggagatcgtcgcgcagcacgcgtacttcgtaaaa
ggcgtggcggacggcccggctattctcagccgctggcgcatggtggtggataaccagggc
gcgctgcactgcgatatcgacatcgcgcgcagcgccgcactgccgccgctgccgcgcgtg
ggcgtcgtctgccagttacgcggcggcgaagagacggcaagctggctcggcctcggcccg
catgagaactacccggaccgcctgagcagcgcgtgcttctcgcgctggacgctgccgctt
tcagagctcaccacgccgtatattttccccggcgaaaacggcctgcgttgcaacacccgc
gagcttaactggaacggctggcaggccgaaggcgagtttcatttctcgctaagcccttac
ggcacgcgtcagctgatggaaaccagccactggcataaattgcagccggaggccgggatc
tggctgaccattgatggcttccatatgggcgttggcggcgatgattcctggacaccgagc
gtgcacccggaatatctgctgaccgcgcgggaataccgctaccgctttaccctgcgcaga
cggcaaggctga

DBGET integrated database retrieval system