KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_03199Help
Entry
ESA_03199         CDS       T00586                                 

Definition
hypothetical protein
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ESA_03199
Enzymes [BR:esa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     ESA_03199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3118924..3119403
Genome map
AA seq 159 aa AA seqDB search
MTLAFIALGSNLAEPLTQVNNALAALARIPGSRVVATSSFYRTPPLGPQDQPDYLNAAVA
LETTLSAEALLDNTQRIELEQGRVRKAERWGPRTLDLDIMLFGDATINTERLIVPHYDMK
NRAFMLLPLSEIAPALRFPDGERLADVLERLDCSAIRHW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
gtgacgctggcctttatcgcgctcggcagcaatctcgccgagccgcttacccaggtcaat
aacgcgctggctgcgctggcgcgtattccgggtagccgcgttgtggcgacctcctctttc
tatcgcacccctccgcttggcccgcaggatcagcccgattatctgaacgccgccgtggcg
ctggagacgacgctcagcgccgaagcacttcttgataacacgcagcgcattgagcttgag
caggggcgcgtacgtaaagcggagcgctgggggccacgcacgctcgatcttgatatcatg
ctgtttggcgatgcgacgataaacaccgagcgcctgatcgttcctcactacgacatgaaa
aaccgcgcttttatgctgctgccgctttcagagattgcacccgcgctgcgcttcccggat
ggcgagcgcctggccgacgtgctcgaacgccttgattgttcagcaattcgccactggtaa

DBGET integrated database retrieval system