KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_03333Help
Entry
ESA_03333         CDS       T00586                                 

Definition
(GenBank) hypothetical protein
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
esa00260  Glycine, serine and threonine metabolism
esa00750  Vitamin B6 metabolism
esa01100  Metabolic pathways
esa01110  Biosynthesis of secondary metabolites
esa01120  Microbial metabolism in diverse environments
esa01230  Biosynthesis of amino acids
Module
esa_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:esa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ESA_03333
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ESA_03333
Enzymes [BR:esa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ESA_03333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ABU78554
UniProt: A7MIJ6
Position
complement(3268322..3269611)
Genome map
AA seq 429 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFSLTEIDEMLEMDFVSRSSKILS
AYIGDEIPTDTLRQRVEKAFTFPAPVSQVTEDIGCLELFHGPTLAFKDFGGRFMAQMLTQ
ISGDKPVTILTATSGDTGAAVAHAFYGLKNVQVVILYPRGKISPLQEKLFCTLGGNIETV
AIDGDFDACQALVKQAFDDEELKAKLGLNSANSINISRLLAQICYYFEAVAQLPQEARNQ
LVVSVPSGNFGDLTAGLLAKSAGLPVKRFIAATNANDTVPRFLQHGEWLPNATVATLSNA
MDVSQPNNWPRVEELFRRKIWRLNELGVATIDDDTTKATMRELRELGYLSEPHAAVAYRA
LRDQLRPGEYGLFLGTAHPAKFKESVEAVLGETLELPPELAERVDLPLLSHSLPADFAAL
RELMMSKAP
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaactttataatctgaaagatcataacgagcaggtcagctttgcgcaggccgtcacg
cagggactgggtaaaaatcaggggctgtttttcccgcatgatttgccggaattcagcctg
actgagatcgacgaaatgctggagatggattttgtctcccgcagcagcaaaatcctctcc
gcttatatcggcgatgaaattccgacggacacgctgcgtcagcgcgtggaaaaggcgttc
accttcccggcgccggtaagccaggtaacggaagatatcggctgtctggagctgttccac
ggcccgacgctggcgttcaaagatttcggcggccgttttatggcgcagatgctgacgcaa
atcagcggcgataaaccggtaaccattctgactgcaacctccggcgacacgggcgcggca
gtagcccacgcgttttacggcctgaaaaacgtgcaggtagtaattctctatccgcgcggc
aaaatcagcccgctgcaggaaaaactgttctgtacgcttggcggcaatattgaaaccgtc
gccatcgacggcgatttcgacgcctgtcaggcgctggtgaaacaggcgtttgatgacgaa
gagctgaaggcgaaacttggccttaactctgctaactccattaacatcagccgcctgctg
gcgcagatctgctactactttgaagctgtcgcgcagctgccgcaggaagcccgcaaccag
ctggtggtgtcggtgccgagcggcaacttcggcgatctcaccgccgggctgctggcaaaa
tccgccgggctgccggtgaagcgctttatcgccgccaccaatgccaacgacaccgtgccg
cgtttcctgcaacacggcgagtggctgccgaatgcgacggtggcgacgctctcgaacgcg
atggatgtgtcacagccaaacaactggccgcgcgtggaagaactcttccgccgtaaaatc
tggcgtcttaacgagctgggtgtggcaaccatcgacgatgacaccacaaaggcaaccatg
cgcgaactgcgcgagctggggtatctctctgagccgcacgcggcggtggcttaccgcgcg
ctgcgcgatcagctacgccctggcgagtacgggctgttcctcggcaccgcgcatccggcg
aaattcaaagagagcgtggaagcggtgcttggcgaaacgctggaactcccgccggagctt
gccgaacgcgtcgatctgccgctgctgtcgcattcgctgccggcggatttcgctgcgctg
cgtgaactgatgatgagcaaagcgccgtaa

DBGET integrated database retrieval system