KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_03369Help
Entry
ESA_03369         CDS       T00586                                 

Definition
(GenBank) hypothetical protein
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
esa00240  Pyrimidine metabolism
esa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ESA_03369
Enzymes [BR:esa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     ESA_03369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: ABU78590
UniProt: A7MGA9
Position
complement(3310654..3311976)
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGHALSDEEIRFFINGIRDNTVSEGQIAALAMTIFFHDMTMPERVSLT
MAMRDSGTVLDWKSLNLNGPVVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHT
GGTLDKLEAIPGFDIFPDDNRFRDIIKNVGVAIIGQTNSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYALSEELAQAIVGVANGAGVRTTALLT
DMNEVLASSAGNAVEVREAVRFLTGDYRNPRLLEVTMALCVEMLLSGGLAKDETEARAKL
QQVLDNGQAAEIFGRMVAAQSGPADFVDNYERYLPAATLSKAVYADRSGFVTQMDTRALG
MAVVAMGGGRRQASDSIDYSVGLTDMARLGEQVDGERPLAIIHAKSEASWQEAAAAVKAA
INVDDTAAKTSPVVYRRISE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgttcctcgctcaagaaattattcgtaaaaagcgcgacggccatgcgctcagcgacgaa
gagatccgcttttttattaacggcattcgcgataacactgtgtccgaaggccagatcgcc
gcgctggcgatgacgattttctttcacgacatgaccatgccggagcgagtctcgctgacg
atggcgatgcgtgattccggcaccgtgctggactggaaaagcctgaacctcaatggcccg
gtcgtggataaacactccaccggcggcgtgggcgacgtgacctcgctgatgcttggcccg
atggtggcggcctgcggcggttacattccgatgatttccgggcgcgggctgggccatacc
ggcggcaccctcgataaactggaagcgattccggggtttgatattttcccggacgacaac
cgctttcgcgacattattaaaaacgtcggcgtggcgataattggccagaccaactcgctg
gcaccggcggataaacgcttctatgcgacgcgtgatatcaccgcgaccgtcgattctatt
ccgcttatcaccgcttcgatcctcgcgaaaaaactcgccgaagggctggacgcgctggtg
atggacgtaaaagtgggcagcggtgcgttcatgccgacttatgcgctctctgaagagctg
gcgcaggcgatcgttggcgtggcgaacggtgcgggcgtgcgcacgaccgcgctgctgacc
gatatgaacgaagtgctggcctccagcgccggtaacgcggtggaagtccgcgaggcggtg
cggttcctgaccggcgattaccgcaacccgcgcttgctggaagtgacgatggcgctgtgc
gtcgagatgctgctctccggggggcttgcgaaagacgagactgaagcgcgcgcgaagctg
caacaggtactggacaacggccaggcggcggagattttcgggcgtatggtggcggcgcaa
agcggcccggcggattttgtcgacaactacgagcgctacctgcccgcggccacgctcagc
aaagcggtatatgccgaccgttccggctttgttacgcaaatggatacccgcgcgctcggt
atggcggtcgtcgccatgggcggcggtcgccgtcaggcgtccgacagcattgattacagc
gtcggcctgaccgatatggcgcgcctcggcgaacaggttgacggcgagcgtccgctggcc
atcatccacgcgaagagcgaagcaagctggcaggaagcggcggcggccgttaaagcggcc
atcaacgttgacgatacggcggcgaaaacgtcaccggttgtctatcgcagaatcagcgaa
taa

DBGET integrated database retrieval system