KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_03380Help
Entry
ESA_03380         CDS       T00586                                 

Definition
hypothetical protein
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:esa00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:esa00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:esa03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:esa03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:esa03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3320730..3321140)
Genome map
AA seq 136 aa AA seqDB search
MTSRRDWRLQQLGITQWVLRRPAALLGEIAIVLPSHIRLVMVAAEPPPLTQPFIKDVLRA
LALDADQVMQLTPDRVAMLHDAHCNSWCLGVDAPPGLPGARLVTPGLETLQRSGPARADL
WQQICEHEDDFLTAER
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgacgagactggcgattacagcaactgggcattacccagtgggtattgcgt
cgccccgccgcgctgctgggggaaatcgccattgtgctgccttctcatattcgcctggtc
atggtggccgccgagccgccgccgctcacgcagccctttataaaagatgtgctgcgcgcg
ctggcgcttgatgccgaccaggtgatgcagttaacccccgatcgcgtggcgatgctgcat
gacgcccactgcaacagctggtgtctgggcgtggatgcgccacctgggctgcccggtgcc
cggctggtgacgccggggctggaaaccttacagcgtagcggtccggcgcgcgccgatctc
tggcaacaaatttgcgagcacgaagatgatttccttactgcagagcgctga

DBGET integrated database retrieval system