KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_03380Help
Entry
ESA_03380         CDS       T00586                                 

Definition
hypothetical protein
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:esa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ESA_03380
   00240 Pyrimidine metabolism
    ESA_03380
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ESA_03380
   03430 Mismatch repair
    ESA_03380
   03440 Homologous recombination
    ESA_03380
Enzymes [BR:esa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     ESA_03380
DNA replication proteins [BR:esa03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     ESA_03380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3320730..3321140)
Genome map
AA seq 136 aa AA seqDB search
MTSRRDWRLQQLGITQWVLRRPAALLGEIAIVLPSHIRLVMVAAEPPPLTQPFIKDVLRA
LALDADQVMQLTPDRVAMLHDAHCNSWCLGVDAPPGLPGARLVTPGLETLQRSGPARADL
WQQICEHEDDFLTAER
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgacgagactggcgattacagcaactgggcattacccagtgggtattgcgt
cgccccgccgcgctgctgggggaaatcgccattgtgctgccttctcatattcgcctggtc
atggtggccgccgagccgccgccgctcacgcagccctttataaaagatgtgctgcgcgcg
ctggcgcttgatgccgaccaggtgatgcagttaacccccgatcgcgtggcgatgctgcat
gacgcccactgcaacagctggtgtctgggcgtggatgcgccacctgggctgcccggtgcc
cggctggtgacgccggggctggaaaccttacagcgtagcggtccggcgcgcgccgatctc
tggcaacaaatttgcgagcacgaagatgatttccttactgcagagcgctga

DBGET integrated database retrieval system