KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_03407Help
Entry
ESA_03407         CDS       T00586                                 

Definition
cryptic 6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:esa00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3348778..3350208)
Genome map
AA seq 476 aa AA seqDB search
MDNNTFPEGFLWGGAIAANQAEGAWREGGKGPATVDMLPHGPNRLAVKLGLDKRTGWRDD
EFYPSHEAIDFYHRYKEDIALMAEMGFTVFRTSIAWSRLYPNGDEQTPNEEGIAFYRALF
SECKKYNIEPLVTLCHFDVPMHLVTEYGSWRSRKMVEFFTRYARTCFEAFDGLVKYWLTF
NEINILLHSPFSGAGLAFEPGENHEQVKYQAAHHELIASAIATRIAHEVNPQNQVGCMLA
GGNFYPYSCKPEDVWAALEKDRENLFFIDVQARGAYPAYTQRLFREKGIVIEKAPEDDEI
LKDTVDFVSFSYYASRCASADMNNQVTSAANIVKSLKNPYIEASEWGWGIDPLGLRITMN
MMYDRYQKPLFLVENGLGAKDAFNENGEIEDDYRISYLREHIRAMREAIEDGIPVMGYTT
WGCIDLVSASTGEMSKRYGFVWVDRDDQGRGTLERKRKKSFWWYKKVIASNGADLD
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggataacaacacttttcccgaaggatttttatggggcggcgcgattgcggcaaaccag
gcggaaggcgcgtggcgcgagggcggcaaagggccagctacggttgatatgctgccgcac
ggcccgaatcgtctggcggtaaagcttgggctggataagcgcaccggctggcgcgacgat
gaattttacccaagccacgaggcgatcgatttttatcaccgctataaagaggatatcgcg
ctgatggccgagatgggctttacggtgtttcgcacgtcgatcgcctggagccgcctctac
ccgaacggcgatgaacagacgccgaacgaagagggcattgcgttttaccgcgcgctgttc
agcgagtgcaaaaaatacaacatcgagccgctggtgacgctgtgccattttgacgtgccg
atgcacctggtgaccgaatatggctcctggcgcagccgtaaaatggtggagtttttcacc
cgctacgcgcgcacctgttttgaagcgttcgacgggctggtgaaatactggctcacgttc
aacgaaatcaacatcctgctgcacagcccgttctccggcgcgggcctggcgtttgagccg
ggcgaaaatcatgaacaggtgaaataccaggccgcgcatcatgagcttattgccagcgct
atcgccacccgcatcgcgcatgaagtgaacccgcaaaaccaggtgggttgtatgctggcg
ggcggcaatttctacccttactcctgcaagccggaagatgtctgggcggcgctggagaaa
gaccgcgaaaacctgtttttcatcgacgtgcaggcgcgcggcgcgtacccggcctacacg
cagcgcctgttccgtgaaaaaggcatcgtgattgaaaaagcgccggaagatgatgagatc
cttaaagataccgtcgatttcgtctcttttagctactacgcctcgcgctgcgcctcggcg
gatatgaataaccaggtgacgagtgcggcgaacatcgtgaaatcgctcaaaaacccgtat
atcgaggcgagcgaatggggctgggggatcgatcctctggggctgcgcatcaccatgaac
atgatgtatgaccgctaccagaaaccgctgttcctggtggagaacggcctcggcgcgaaa
gacgcgtttaatgaaaacggcgaaatcgaagatgactaccgcatcagttatctgcgcgag
catatccgcgcgatgcgcgaagccatcgaagacggcattccggtgatgggctacaccacc
tggggttgcatcgatctggtgtcggcctccaccggcgagatgagcaagcgctacggtttt
gtctgggtggatcgcgacgaccagggccgcggcacgctggagcgcaaacgtaagaaatcg
ttctggtggtataaaaaagtgatcgccagcaacggggccgatctcgactga

DBGET integrated database retrieval system