KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_03407Help
Entry
ESA_03407         CDS       T00586                                 

Definition
(GenBank) hypothetical protein
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
esa00010  Glycolysis / Gluconeogenesis
esa00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:esa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ESA_03407
   00500 Starch and sucrose metabolism
    ESA_03407
Enzymes [BR:esa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     ESA_03407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: ABU78625
UniProt: A7MG87
Position
complement(3348778..3350208)
Genome map
AA seq 476 aa AA seqDB search
MDNNTFPEGFLWGGAIAANQAEGAWREGGKGPATVDMLPHGPNRLAVKLGLDKRTGWRDD
EFYPSHEAIDFYHRYKEDIALMAEMGFTVFRTSIAWSRLYPNGDEQTPNEEGIAFYRALF
SECKKYNIEPLVTLCHFDVPMHLVTEYGSWRSRKMVEFFTRYARTCFEAFDGLVKYWLTF
NEINILLHSPFSGAGLAFEPGENHEQVKYQAAHHELIASAIATRIAHEVNPQNQVGCMLA
GGNFYPYSCKPEDVWAALEKDRENLFFIDVQARGAYPAYTQRLFREKGIVIEKAPEDDEI
LKDTVDFVSFSYYASRCASADMNNQVTSAANIVKSLKNPYIEASEWGWGIDPLGLRITMN
MMYDRYQKPLFLVENGLGAKDAFNENGEIEDDYRISYLREHIRAMREAIEDGIPVMGYTT
WGCIDLVSASTGEMSKRYGFVWVDRDDQGRGTLERKRKKSFWWYKKVIASNGADLD
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggataacaacacttttcccgaaggatttttatggggcggcgcgattgcggcaaaccag
gcggaaggcgcgtggcgcgagggcggcaaagggccagctacggttgatatgctgccgcac
ggcccgaatcgtctggcggtaaagcttgggctggataagcgcaccggctggcgcgacgat
gaattttacccaagccacgaggcgatcgatttttatcaccgctataaagaggatatcgcg
ctgatggccgagatgggctttacggtgtttcgcacgtcgatcgcctggagccgcctctac
ccgaacggcgatgaacagacgccgaacgaagagggcattgcgttttaccgcgcgctgttc
agcgagtgcaaaaaatacaacatcgagccgctggtgacgctgtgccattttgacgtgccg
atgcacctggtgaccgaatatggctcctggcgcagccgtaaaatggtggagtttttcacc
cgctacgcgcgcacctgttttgaagcgttcgacgggctggtgaaatactggctcacgttc
aacgaaatcaacatcctgctgcacagcccgttctccggcgcgggcctggcgtttgagccg
ggcgaaaatcatgaacaggtgaaataccaggccgcgcatcatgagcttattgccagcgct
atcgccacccgcatcgcgcatgaagtgaacccgcaaaaccaggtgggttgtatgctggcg
ggcggcaatttctacccttactcctgcaagccggaagatgtctgggcggcgctggagaaa
gaccgcgaaaacctgtttttcatcgacgtgcaggcgcgcggcgcgtacccggcctacacg
cagcgcctgttccgtgaaaaaggcatcgtgattgaaaaagcgccggaagatgatgagatc
cttaaagataccgtcgatttcgtctcttttagctactacgcctcgcgctgcgcctcggcg
gatatgaataaccaggtgacgagtgcggcgaacatcgtgaaatcgctcaaaaacccgtat
atcgaggcgagcgaatggggctgggggatcgatcctctggggctgcgcatcaccatgaac
atgatgtatgaccgctaccagaaaccgctgttcctggtggagaacggcctcggcgcgaaa
gacgcgtttaatgaaaacggcgaaatcgaagatgactaccgcatcagttatctgcgcgag
catatccgcgcgatgcgcgaagccatcgaagacggcattccggtgatgggctacaccacc
tggggttgcatcgatctggtgtcggcctccaccggcgagatgagcaagcgctacggtttt
gtctgggtggatcgcgacgaccagggccgcggcacgctggagcgcaaacgtaagaaatcg
ttctggtggtataaaaaagtgatcgccagcaacggggccgatctcgactga

DBGET integrated database retrieval system