KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_03417Help
Entry
ESA_03417         CDS       T00586                                 

Definition
hypothetical protein
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:esa00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3359469..3361529)
Genome map
AA seq 686 aa AA seqDB search
MNKFAPLSPKVSALLHGADYNPEQWENYPGTVESDIAMMQQAKCNVMSVGIFSWAKLEPE
EGMFRFEWLDEIIDKLYQGGIHVFLATPSGARPAWMSQKYPQVLRVGRDRVPALHGGRHN
HCMSSPVYRDKTATINRLLAERYAHHPAVLGWHISNEYGGECHCDLCQENFRGWLKARYG
TLDKLNEAWWSTFWSHTFTDWSQIESPAPQGENSIHGLNLDWRRFNTAQVTDFCRHELAP
LKAVNPELPATTNFMEYFYDYDYWQLAEPLDFISWDSYPMWHRDKDETELACYTAMYHDL
MRTLKHGKPFVLMESTPGTTNWQPTSKLKKPGMHILSSLQAVAHGADSVQYFQWRKSRGS
VEKFHGAVVDHVGHIDTRIGREVAQLGDILSQLDPVVGARVDAQVAVIFDWESRWAMDDA
QGPRNLGLEYEKTVAEHYRPFWELGIAVDIINADADLSGYKLVIAPMLYMVRDGFAQRAE
AFVEQGGHFVTTYWSGIVNETDLCHLGGFPGPLRKLLGIWAEEIDCLADGERNLIQGLAG
NEAGLQGPYQVRHLCDLIHTEGATALATYRDDFYAGRAAVTVNAFGAGKAWYVASRNDLA
FQRDFFGNIISELSLARALEADFPPGVTAHARHDGESAFIFVENYTGAPQSVTLPEGCAD
MLTGDALSGRLSLAPWGCRILRRRLA
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaatttgcgcctttaagtccgaaggtcagcgcccttttgcacggtgcggactat
aacccggagcaatgggagaactaccccggcacggtagagagcgatatcgccatgatgcag
caggcgaaatgcaacgtgatgtcggtgggcatttttagctgggcgaagcttgagcctgaa
gaaggcatgtttcgcttcgagtggctcgacgagattatcgacaagctgtatcagggcggc
attcacgtgtttctcgccacgccgagcggcgcgcgtccggcctggatgtcgcagaagtat
ccgcaggtgctgcgcgtcgggcgcgaccgcgttccggcgctgcatggcggccgtcataac
cactgcatgagttcgccggtctatcgcgacaaaaccgccaccatcaaccgcctgctggcg
gagcgttacgcgcaccatccggcggtgctcggctggcatatctccaacgaatatggcggc
gagtgtcattgcgatttgtgccaggagaatttccgcggctggctgaaagcgcgctacggc
acgctcgataaactcaacgaggcgtggtggagcactttctggagccacacctttaccgac
tggtcgcagattgaatccccggcgccgcagggcgaaaactccattcacggtctgaatctc
gactggcggcgctttaataccgcgcaggtcactgacttctgccgtcacgaactggccccg
ctgaaggcggtgaacccggaattaccggccaccaccaacttcatggagtatttctacgat
tacgactactggcagcttgccgaaccgctcgactttatctcctgggacagctacccgatg
tggcaccgcgataaagacgaaaccgagcttgcctgctacaccgcgatgtaccacgacctg
atgcgcaccttaaagcacggcaaaccgtttgtgctgatggaatcgacgccgggtacgacc
aactggcagcccaccagcaagctgaaaaagccgggcatgcatattctctcttcgctccag
gcggtggcgcacggcgcggattcggtgcagtacttccagtggcgcaagagccgcggctcg
gtggagaaattccacggcgcggtggtggatcacgtcggtcatatcgacacccgcatcgga
cgcgaagtggcgcagcttggcgatatcttaagccagcttgatccggtggtcggcgcgcgc
gtggacgcgcaggtggcggtgattttcgactgggaaagccgctgggcgatggatgacgcg
caggggccgcgcaacctggggctggaatatgaaaagaccgtcgccgagcattaccggccg
ttctgggagctggggatcgcggtcgatatcattaacgccgacgccgatctgagcggctat
aaactggttatcgcgccgatgctctacatggtgcgtgacgggtttgcgcagcgcgccgaa
gcctttgtcgaacagggcggccacttcgtgaccacctactggagtggcatcgtcaacgag
accgatctttgccatctcggcggtttccccggcccgctgcgtaagctgctgggcatctgg
gcggaagagattgactgccttgccgacggcgaacgcaacctgattcaggggctcgcgggc
aacgaggcgggcttacaggggccgtatcaggtgcgccatctgtgcgatctcatccacacc
gaaggcgcgacggcgcttgccacctatcgcgacgatttctatgccggacgcgcggcggtg
acggtgaacgcgtttggcgcgggcaaagcctggtatgtggcctcgcgtaacgatctcgcc
ttccagcgcgatttcttcggcaacatcattagcgagctgtcgcttgcgcgcgcgctggag
gcggatttcccgccgggcgtcaccgcgcatgcccgccacgatggcgaatccgcgtttatc
ttcgttgaaaactacaccggcgcgccgcagtcggtgacgctgccggagggctgcgccgat
atgctgaccggcgacgcgctgagcggcaggctgtcgctcgccccctggggctgtcgcatt
ctgcgccgccgcctcgcctga

DBGET integrated database retrieval system