KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_03568Help
Entry
ESA_03568         CDS       T00586                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:esa00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3506844..3507698)
Genome map
AA seq 284 aa AA seqDB search
MAMKLFAQGSTLELSHPHVMGILNVTPDSFSDGGQHNTLTEAVKHANAMINAGATIIDVG
GESTRPGAAEVSVEEELSRVIPVVEALAQRFEVWVSVDTSKPEVIRESARAGAHIINDIR
SLTEPGALEAAAESGLPVCLMHMQGQPKTMQQAPHYDDVFADVTRFFEQHIARCEAAGIT
KEKIILDPGFGFGKNLTHNYQLLARLSEFRRFGMPLLVGMSRKSMIGQLLNVGPDQRLPG
SLACAVMAAMQGAQIIRVHDVKETVEAMRVVEATLSAKDKKYYE
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgaaactcttcgcccagggctcaacgctcgaactttctcacccgcatgtcatg
gggatcctgaatgttacgccggattctttctccgatggcggtcagcacaacacgctcaca
gaggcggtgaaacacgcgaacgcgatgattaacgccggtgcgaccatcattgatgttggc
ggcgagtcgacacgccccggagcggcggaagtgagcgtggaagaagagctttcccgcgtg
ataccggtggtggaggcgctggcgcagcgctttgaggtctgggtgtctgtcgatacctct
aaaccggaagtgatccgtgaatcggcgcgtgccggggcgcatatcattaacgatattcga
tcgctgacagagccgggcgcgcttgaggcggcggcagagagcggattgccggtttgcctg
atgcatatgcagggccagccgaaaacgatgcagcaggcaccgcattacgacgatgtcttt
gccgacgtcacacgtttttttgagcagcacatcgcccgttgcgaggcggcgggcattaca
aaagaaaaaatcatactcgacccgggattcggtttcggtaaaaatctcacccacaattac
cagcttctcgcccggctttcagaattccgacgtttcggaatgcctttgctggtgggaatg
tcgcgtaaatcgatgattggccagttacttaacgtcggacccgatcagcgcctgcccgga
agccttgcctgcgcggtgatggcggctatgcagggggcgcaaattattcgtgtccatgac
gtcaaagaaacggtcgaagcgatgcgcgtggtggaagcaactctttcagcgaaggataaa
aaatactatgagtaa

DBGET integrated database retrieval system