KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_03735Help
Entry
ESA_03735         CDS       T00586                                 

Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:esa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ESA_03735
Enzymes [BR:esa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     ESA_03735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3676130..3677122)
Genome map
AA seq 330 aa AA seqDB search
MTRHRNSWFSREAGFAAFTMGALTDFWQQREEDEFLGVDDIPVRFVRFRAENHDRVIVVC
PGRIETYVKYAELAYDLFHCGFDVLIIDHRGQGRSGRLLEDTHRGHVVNFSDYVDDFERF
WQQEVATGPWRKRYLLAHSMGGAIGTLFLLRNPKAFDAVALCAPMFGIIIRLPDWMLRSI
LDWAEEYPSLRDGYAIGTGRWRPLPFSLNMLTHSHERYRRNLRFYADEPQLRVGGPTYHW
VREGIQAGEQVLAGATDSTTPLLLLQAELERVVDNRSHDRFCELRAAAGHPCWGGKPYVI
KGAYHEILFEQDAMRAEALNAIVDFFDEHN
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaccagacacaggaacagttggttttcacgggaagccggattcgcggcgttcaccatg
ggtgcgctgacagatttctggcaacagcgcgaagaagatgagtttttgggcgtggatgat
attccggtgcgctttgtgcgttttcgtgcggaaaaccacgatcgcgttattgtcgtctgc
cccggccgcatcgaaacctacgttaagtatgcggaactggcatacgatctgttccactgc
gggtttgatgtgctgattatcgaccaccgcgggcaggggcgttccgggcggctgctggaa
gatacccaccgcgggcacgtggtgaatttcagcgattatgtcgatgatttcgagcgtttc
tggcagcaggaggtcgcgaccggcccgtggcggaaacgctatctgctggcgcattcgatg
gggggcgcgattggcacgctgtttctgctgcgtaacccaaaagcgtttgatgccgtggcg
ctctgcgccccgatgttcggcattattatccgtctgccggactggatgctgcgctcgatc
ctcgactgggcggaagagtacccgtcgctgcgcgatggttacgccattggcaccggacgc
tggcgaccgctgcccttcagcctcaacatgctgacgcacagccacgagcgctaccggcgc
aatttgcgtttttacgccgatgaaccgcagctgcgcgtcggcgggcctacgtatcactgg
gtgcgggaaggcatccaggcaggagaacaggtgctggcgggggccaccgacagcaccacg
ccgctattgttactccaggcagagctggaacgtgtggtggataaccgctcgcacgaccgc
ttctgtgaacttcgcgccgcggcgggccacccgtgttgggggggtaaaccttacgtcatc
aaaggtgcgtaccatgagatcctgtttgagcaggacgctatgcgcgccgaagcgctgaat
gccattgtcgattttttcgacgagcataactga

DBGET integrated database retrieval system