KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_03754Help
Entry
ESA_03754         CDS       T00586                                 

Definition
(GenBank) hypothetical protein
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
esa00860  Porphyrin and chlorophyll metabolism
esa01100  Metabolic pathways
esa01110  Biosynthesis of secondary metabolites
esa01120  Microbial metabolism in diverse environments
Module
esa_M00121  Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:esa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ESA_03754
Enzymes [BR:esa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     ESA_03754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ABU78951
UniProt: A7MQJ2
Position
3695360..3696100
Genome map
AA seq 246 aa AA seqDB search
MTILVTRPSPAGEELVSRLRALGQEAWSFPLIEFCPGRELPQLPALLDALAPHDLLFALS
QHAVSFANAHLQRLGQRWPRAVEAFAIGRTTALALHQVSGLHVHYPRDREISEVLLQLPE
LQNVAGKRALILRGNGGRELLGETLTERGATVTFCECYQRSAKIYDGTEEAHRWHTRGIT
TLVVTSGEMLRQLHDLMPPWYRENWLLRCRLVVVSERLATIARELGWQNILVADNADNDA
LLRALQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacgattctggtcacccgcccctctcccgccggggaggaattagtgagccgcctgcgc
gcactggggcaggaggcctggagttttccgctgatcgagttctgccctggccgggagttg
ccgcaactgcccgcgctgctcgacgcgctcgcgccgcacgatctcctctttgcgttgtcg
caacacgcggtgagttttgcgaacgcgcacttacagcgtctggggcagcgctggcctcgc
gccgtcgaagcgttcgccatcgggcgcaccaccgcgctggcgctgcatcaggtcagcggt
ttgcacgtccattacccgcgcgatcgggaaatcagcgaagtcttgctacaattacctgaa
ttacaaaacgttgccggtaagcgtgcgcttatcctgcgcggcaacggcggtcgcgaactg
ttaggggaaaccttaacggagcgcggcgcaaccgtgacgttttgcgaatgctatcaacgt
agcgcgaaaatttacgacggcaccgaggaagcgcaccgctggcatacgcgcggcattacc
acgctggtggtgacgagcggcgagatgctgcgccagctgcatgacctgatgccgccgtgg
tatcgcgaaaactggttgctgcgctgtcggctggtggtcgtcagcgagcgtctggcgacg
attgccagggagcttggctggcagaacattctggtcgctgataacgccgataacgacgcg
ctgctgcgcgcgttgcaataa

DBGET integrated database retrieval system