KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_03835Help
Entry
ESA_03835         CDS       T00586                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    ESA_03835
Enzymes [BR:esa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     ESA_03835
Exosome [BR:esa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ESA_03835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3786682..3788199
Genome map
AA seq 505 aa AA seqDB search
MMTTEKKYIVALDQGTTSSRAVVLDHDANIVSVSQREFEQIYPRPGWVEHDPMEIWASQS
STLVEALAKADISSDQIAAIGITNQRETAVVWERETGKPIHNAIVWQCRRTSEICEKLKR
DGMEDYVRQATGLVIDPYFSGTKVKWILDHVEGARERAKRGELLFGTVDTWLIWKMTQGR
VHVTDYTNASRTMLFNIHELDWDDRMLEALDIPRAMLPQVRKSSEVYGQTNIGGKGGTRI
PIAGIAGDQQAALFGQLCVKEGMAKNTYGTGCFMLMNTGEKAVASTHGLLTTIACGPRGE
VNYALEGAVFMAGASIQWLRDEMKLISDAFDSEYFATKVKDTNGVYVVPAFTGLGAPYWD
PYARGAIFGLTRGVNSNHIIRATLESIAYQTRDVLEAMQADSGIRLHALRVDGGAVANNF
LMQFQSDILGTRVERPEVREVTALGAAYLAGLAVGYWQNLDELQEKAVIEREFRPGIETT
ERNYRYEGWRKAVKRAMAWEEHDKE
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgatgactacagaaaaaaaatatatcgttgcgctcgaccagggcacgaccagctcccgc
gccgttgtgctggatcatgacgccaacatcgtcagcgtctcccagcgtgaatttgaacaa
atctacccgcgtccaggctgggtagaacacgacccgatggaaatctgggcctcccagagc
tccacgctggtagaagccctcgcgaaagcggatatcagttccgatcagattgccgctatc
ggcattaccaaccagcgcgaaacggcggtggtctgggagcgtgaaaccggcaaaccgatt
cataacgctattgtctggcagtgccgccgtacctcagagatttgcgaaaaactgaaacgc
gacggcatggaagattacgtgcgccaggcgaccggcctcgtcattgacccgtacttctcc
ggcaccaaagtgaagtggattcttgatcacgtcgaaggtgcccgcgagcgcgcgaagcgc
ggtgaactgctgttcggcaccgtcgacacctggcttatctggaaaatgacccagggccgc
gtgcatgtgaccgactacaccaacgcctcgcgcaccatgctgttcaacatccatgagctt
gactgggatgacagaatgctggaggcgctggatattccgcgcgccatgctgccgcaggtg
cgtaagtcgtctgaagtgtacggccagactaacatcggcggtaaaggcggcacccgtatt
cctatcgccggtatcgcgggcgaccagcaggcggcgctgtttggccagctctgcgtgaaa
gaaggcatggcgaaaaacacctacggcaccggctgctttatgctgatgaacaccggcgaa
aaagcggtggcctccacccacggtctgctgaccaccatcgcctgcggcccgcgcggtgaa
gtgaactatgcgctggaaggcgcggtgtttatggcgggcgcgtcaattcagtggctgcgc
gacgagatgaagctcatcagcgacgcgtttgactccgaatatttcgccaccaaagtgaaa
gacaccaacggcgtctatgtggtaccggcgtttaccggcctcggcgcaccgtactgggat
ccgtatgcccgcggcgcgattttcggcctcacccgcggcgtgaactcgaatcacatcatt
cgcgccacgctggaatccatcgcctaccagacccgcgacgtgctggaagcgatgcaggcc
gactccggcattcgtctgcacgccctgcgcgtggatggcggcgcggtggcgaacaacttc
ctgatgcagttccagtctgacattctcggcacccgcgtggagcgcccggaagtccgtgaa
gtcaccgcgctgggcgcagcctatctggcgggtcttgcggtcggctactggcagaatctg
gacgaactgcaggaaaaagcggtaattgagcgtgaattccgcccgggtattgaaaccacc
gagcgtaactaccgctacgaaggctggcgcaaggcggttaaacgcgctatggcctgggaa
gagcacgacaaagagtaa

DBGET integrated database retrieval system