KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_03854Help
Entry
ESA_03854         CDS       T00586                                 

Definition
hypothetical protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:esa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ESA_03854
  Lipid metabolism
   00561 Glycerolipid metabolism
    ESA_03854
   00600 Sphingolipid metabolism
    ESA_03854
Enzymes [BR:esa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     ESA_03854
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3805229..3807352)
Genome map
AA seq 707 aa AA seqDB search
METRIHRLTSPTTDVVIKTRPFAEILYWGPHLAHFSEHDCASLVRPVANGRLDTDSPVTL
MAENGHGLFGAPGLEGHRNGLDASPVFTTQDVNQNGQTLVITSEDATAGLRLVSELSLSD
SGVLKVRHGLTNLRDGAWQVDRFAVTLPVAERAFEVMAFHGRWIREFQPHRVTLSHDGFV
LENRRGRTSHEHFPALIAGTPGFGEQHGDVWGVHLGWSGNHRLKCEAKTDGRRYLQAEAL
YLPGEMALATGETLHTPWLYASHSTRGLNGMSQQFHRFLRKEIIRFPGNKPRPVHLNTWE
GIYFDHQPEYIMQMATRAAALGVERFIIDDGWFKGRNDDHAALGDWYLDEQKYPDGLMPV
INHVKSLGMEFGIWVEPEMINPDSDLYRAHPDWVLALPGYPKTTGRHQWVLNLNISAAFD
YLLERMSWLLGEHPVDYVKWDMNRELVQPGHAGKAAADAQTRQFYRLLDVLRARFPHVEF
ESCASGGGRIDFEVLTRTHRFWASDNNDALERNTIQRGMSYFFPPEVMGAHIGNPRCHAT
FRQHSIEFRGLTALFGHMGLELDPVSAGEQEAAGYQRYAALYKEWRELIHTGDLWRVEMP
DAATQVQGVVSQDKTQGLFLVSQLAMPDYTLPGALRVPGLDPQARYQVRLVDHPNIQLTG
EGGHTMRKLPGWMSEPVSASGEWLAQAGLQLPVLDPETAMLIAFERV
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atggaaacccgcattcatcgactcaccagccccacaaccgatgttgttatcaaaacgcgc
ccgttcgctgaaattctctactgggggccgcaccttgcgcacttttcggagcacgattgc
gcgagcctcgtacgcccggtcgctaatggccgtctggataccgattcacccgtcacgtta
atggcggagaacggccacgggctgtttggcgcgccggggctggaagggcaccgcaatggg
ctggacgcctcgccggtgtttaccacgcaggacgtcaaccagaacgggcagacgctggta
attaccagtgaagacgccaccgccgggctgcggctcgtgagcgagctttcgctcagcgac
agcggcgtgctaaaggtgcgccacggcctgaccaatctgcgcgacggtgcctggcaggtg
gatcgtttcgcggtcacgctgccggtggcggaacgggcgtttgaagtgatggcgtttcat
ggccgctggatacgtgagttccagccgcaccgcgtaacgttaagccacgacggctttgtg
ctggaaaaccgccgcgggcgcacctcgcacgagcattttccggcgcttatcgccggtacg
ccgggttttggcgagcagcacggcgatgtctggggcgtgcatcttgggtggagcggcaac
caccggctgaagtgcgaagcgaaaaccgacgggcggcgctatctccaggccgaggcgctc
tatctgccgggtgaaatggcgctggcgaccggcgagacgctgcacacgccgtggctctac
gcgagccactccacgcgcggtctgaacggtatgagccagcagtttcaccgctttctgcgt
aaggaaatcatccgttttcctggcaacaaaccgcgcccggtgcacctcaacacctgggag
gggatctacttcgaccatcagccggaatacatcatgcagatggcgaccagagctgcggcg
ctcggtgtggagcgctttatcattgacgacggctggtttaagggccgcaacgacgaccac
gcggcgctcggcgactggtatctcgatgagcagaaatacccggacggcctgatgccggtg
attaatcacgtgaaaagtctcgggatggagttcggcatctgggtggagccggagatgatc
aaccccgattccgatctttaccgcgcgcacccggactgggtgctggcgctgccgggctac
ccgaaaaccaccggacgccatcagtgggtgcttaatctcaacatttctgccgccttcgat
tacctgctggaacgcatgagctggcttctgggcgagcatccggttgattacgtgaagtgg
gacatgaaccgcgagctggtgcagccgggccacgcgggcaaagcggcggcagacgcccag
acgcgtcagttctatcgcctgctggatgtgctgcgcgcgcgtttcccgcacgttgaattt
gagtcctgcgcgtccggcggcgggcgtatcgatttcgaagtgctgacgcgcacgcaccgc
ttctgggcctccgacaacaacgacgcgctggagcgcaacaccatccagcgcggcatgagc
tacttcttcccgccggaagtgatgggcgcgcatatcggcaacccgcgctgccacgcgacg
ttccgccagcacagcattgaatttcgcggcctgacggcgctgttcggtcatatgggcctg
gagctggacccggtcagcgctggcgagcaggaggcggcgggctatcagcgctatgccgcg
ctttataaggaatggcgtgagctgatccacaccggagacctgtggcgcgtagagatgccg
gacgccgccacgcaggtgcagggcgtcgtcagtcaggataagacgcaggggctgtttctg
gtaagccagctggcgatgccggattacacgctgccaggcgcgctgcgcgtgccggggctc
gatccgcaggcccgttaccaggtgcggctggtggatcatccgaatattcagttgaccggc
gaaggcggccacaccatgcgcaaactgccgggctggatgagcgagcctgtcagcgccagc
ggcgaatggctggcgcaggcggggctgcaactgccggtgctcgaccccgaaactgcgatg
cttatcgcgtttgagcgcgtgtaa

DBGET integrated database retrieval system