KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_03854Help
Entry
ESA_03854         CDS       T00586                                 

Definition
hypothetical protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:esa00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:esa00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:esa00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3805229..3807352)
Genome map
AA seq 707 aa AA seqDB search
METRIHRLTSPTTDVVIKTRPFAEILYWGPHLAHFSEHDCASLVRPVANGRLDTDSPVTL
MAENGHGLFGAPGLEGHRNGLDASPVFTTQDVNQNGQTLVITSEDATAGLRLVSELSLSD
SGVLKVRHGLTNLRDGAWQVDRFAVTLPVAERAFEVMAFHGRWIREFQPHRVTLSHDGFV
LENRRGRTSHEHFPALIAGTPGFGEQHGDVWGVHLGWSGNHRLKCEAKTDGRRYLQAEAL
YLPGEMALATGETLHTPWLYASHSTRGLNGMSQQFHRFLRKEIIRFPGNKPRPVHLNTWE
GIYFDHQPEYIMQMATRAAALGVERFIIDDGWFKGRNDDHAALGDWYLDEQKYPDGLMPV
INHVKSLGMEFGIWVEPEMINPDSDLYRAHPDWVLALPGYPKTTGRHQWVLNLNISAAFD
YLLERMSWLLGEHPVDYVKWDMNRELVQPGHAGKAAADAQTRQFYRLLDVLRARFPHVEF
ESCASGGGRIDFEVLTRTHRFWASDNNDALERNTIQRGMSYFFPPEVMGAHIGNPRCHAT
FRQHSIEFRGLTALFGHMGLELDPVSAGEQEAAGYQRYAALYKEWRELIHTGDLWRVEMP
DAATQVQGVVSQDKTQGLFLVSQLAMPDYTLPGALRVPGLDPQARYQVRLVDHPNIQLTG
EGGHTMRKLPGWMSEPVSASGEWLAQAGLQLPVLDPETAMLIAFERV
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atggaaacccgcattcatcgactcaccagccccacaaccgatgttgttatcaaaacgcgc
ccgttcgctgaaattctctactgggggccgcaccttgcgcacttttcggagcacgattgc
gcgagcctcgtacgcccggtcgctaatggccgtctggataccgattcacccgtcacgtta
atggcggagaacggccacgggctgtttggcgcgccggggctggaagggcaccgcaatggg
ctggacgcctcgccggtgtttaccacgcaggacgtcaaccagaacgggcagacgctggta
attaccagtgaagacgccaccgccgggctgcggctcgtgagcgagctttcgctcagcgac
agcggcgtgctaaaggtgcgccacggcctgaccaatctgcgcgacggtgcctggcaggtg
gatcgtttcgcggtcacgctgccggtggcggaacgggcgtttgaagtgatggcgtttcat
ggccgctggatacgtgagttccagccgcaccgcgtaacgttaagccacgacggctttgtg
ctggaaaaccgccgcgggcgcacctcgcacgagcattttccggcgcttatcgccggtacg
ccgggttttggcgagcagcacggcgatgtctggggcgtgcatcttgggtggagcggcaac
caccggctgaagtgcgaagcgaaaaccgacgggcggcgctatctccaggccgaggcgctc
tatctgccgggtgaaatggcgctggcgaccggcgagacgctgcacacgccgtggctctac
gcgagccactccacgcgcggtctgaacggtatgagccagcagtttcaccgctttctgcgt
aaggaaatcatccgttttcctggcaacaaaccgcgcccggtgcacctcaacacctgggag
gggatctacttcgaccatcagccggaatacatcatgcagatggcgaccagagctgcggcg
ctcggtgtggagcgctttatcattgacgacggctggtttaagggccgcaacgacgaccac
gcggcgctcggcgactggtatctcgatgagcagaaatacccggacggcctgatgccggtg
attaatcacgtgaaaagtctcgggatggagttcggcatctgggtggagccggagatgatc
aaccccgattccgatctttaccgcgcgcacccggactgggtgctggcgctgccgggctac
ccgaaaaccaccggacgccatcagtgggtgcttaatctcaacatttctgccgccttcgat
tacctgctggaacgcatgagctggcttctgggcgagcatccggttgattacgtgaagtgg
gacatgaaccgcgagctggtgcagccgggccacgcgggcaaagcggcggcagacgcccag
acgcgtcagttctatcgcctgctggatgtgctgcgcgcgcgtttcccgcacgttgaattt
gagtcctgcgcgtccggcggcgggcgtatcgatttcgaagtgctgacgcgcacgcaccgc
ttctgggcctccgacaacaacgacgcgctggagcgcaacaccatccagcgcggcatgagc
tacttcttcccgccggaagtgatgggcgcgcatatcggcaacccgcgctgccacgcgacg
ttccgccagcacagcattgaatttcgcggcctgacggcgctgttcggtcatatgggcctg
gagctggacccggtcagcgctggcgagcaggaggcggcgggctatcagcgctatgccgcg
ctttataaggaatggcgtgagctgatccacaccggagacctgtggcgcgtagagatgccg
gacgccgccacgcaggtgcagggcgtcgtcagtcaggataagacgcaggggctgtttctg
gtaagccagctggcgatgccggattacacgctgccaggcgcgctgcgcgtgccggggctc
gatccgcaggcccgttaccaggtgcggctggtggatcatccgaatattcagttgaccggc
gaaggcggccacaccatgcgcaaactgccgggctggatgagcgagcctgtcagcgccagc
ggcgaatggctggcgcaggcggggctgcaactgccggtgctcgaccccgaaactgcgatg
cttatcgcgtttgagcgcgtgtaa

DBGET integrated database retrieval system