KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_03885Help
Entry
ESA_03885         CDS       T00586                                 

Definition
(GenBank) hypothetical protein
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:esa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ESA_03885
   01230 Biosynthesis of amino acids
    ESA_03885
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ESA_03885
   00051 Fructose and mannose metabolism
    ESA_03885
   00562 Inositol phosphate metabolism
    ESA_03885
Enzymes [BR:esa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ESA_03885
Exosome [BR:esa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ESA_03885
  Exosomal proteins of bladder cancer cells
   ESA_03885
  Exosomal proteins of melanoma cells
   ESA_03885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3836980..3837729
Genome map
AA seq 249 aa AA seqDB search
MGNWKLNGSRHMVNELVANLRKELAGVSGCDVAIAPPAMYLDLAKQAAAGSHIILGAQNV
DVNLSGAFTGETSAEMLKDIGAKYIIIGHSERRTYHAESDELIAKKFAVLKAQGLVPVLC
IGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGVVIAYEPVWAIGTGKSATPAQAQAV
HKFIRDHIAKADAKIAEQVIIQYGGSVNAANAAELFTQPDIDGALVGGASLKADAFAVIV
KAAEEAKKA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgggtaactggaaactgaacggcagccgccacatggtaaacgagctggtagctaacctg
cgtaaagagctggctggcgtatctggctgcgacgtagcgatcgccccgccggcgatgtat
ctggatctggccaagcaggccgctgctggcagccacatcattcttggtgcccagaacgtc
gacgttaacctctccggcgcgttcaccggtgaaacttccgctgaaatgcttaaagatatc
ggcgctaaatacatcattatcggccactccgagcgtcgtacttaccacgcggaatctgac
gagctgatcgcgaaaaaattcgccgtgctgaaagcgcagggtctggtgccggtactgtgc
atcggtgaaaccgaagctgaaaacgaagcgggcaaaacggaagaagtctgcgcacgtcag
atcgacgctgtgctgaaaacccagggcgccgcggcgtttgaaggcgttgtgattgcttac
gaaccggtatgggctatcggtaccggcaaatccgccactccggcgcaggcacaggcggtt
cacaaattcatccgtgaccacatcgccaaagccgacgcgaaaatcgccgagcaggttatc
attcagtacggcggttctgtaaacgcggctaacgcggcagagctgttcacccagccggac
atcgacggcgcgctggtgggcggtgcctctctgaaagcggacgcgttcgcggttatcgtg
aaagccgctgaagaagcgaaaaaagcgtaa

DBGET integrated database retrieval system