KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_04127Help
Entry
ESA_04127         CDS       T00586                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:esa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ESA_04127
   01230 Biosynthesis of amino acids
    ESA_04127
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ESA_04127
   00030 Pentose phosphate pathway
    ESA_04127
   00051 Fructose and mannose metabolism
    ESA_04127
   00052 Galactose metabolism
    ESA_04127
  Energy metabolism
   00680 Methane metabolism
    ESA_04127
Enzymes [BR:esa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ESA_04127
Protein phosphatases and associated proteins [BR:esa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ESA_04127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4081630..4082592
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVFGVYDGYLGLYEDRMIQLDRYSVSD
MINRGGTFLGSARFPEFREEHIRAVAIENMKKRGIDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDVAGTDYTIGYFTALHTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLA
AAIAGGCEFIVLPEVEFNREDLVAEIKAGIAKGKKHAIVAITEHICDIDELAKYIETETK
RETRATVLGHIQRGGSPVPYDRILASRMGAYAIELLLQGHGGRCVGIQNEKMVHHDIIDA
IENMKRPFKGDWLECAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatcggtgtgttgacgagtggcggtgatgcgccaggcatgaacgccgcc
atccgcggtgttgtccgcgcggcgctgacggaaggtctggaagtgttcggcgtttacgac
ggctatcttggcctgtatgaagaccgcatgatccagctcgaccgctacagcgtttccgac
atgatcaaccgcggcggcaccttcctcggttccgcgcgcttcccggaattccgcgaagaa
catatccgtgccgtggctatcgagaacatgaagaaacgcggtatcgacgcgctggtggtc
atcggcggcgacggctcctacatgggtgctaaacgcctgaccgaaatgggcttcccgtgc
atcggcctgccgggcaccatcgataacgacgtcgcaggcaccgattacaccatcggttac
ttcaccgcgctgcacaccgtggttgaggcgattgaccgtctgcgcgacacctcttcttcc
caccagcgtatttccattgtggaagtgatggggcgctactgtggcgacctgactctggcg
gcggccatcgcgggcggttgcgaatttatcgttctgccggaagtggagttcaaccgcgaa
gatctggtggcagaaatcaaagccggcatcgcgaaaggtaaaaaacacgctatcgttgcg
atcaccgagcacatctgcgacatcgacgagctggcgaaatacatcgaaaccgaaaccaaa
cgcgaaacccgcgcgacggtgctcggccatatccagcgcggcggctcgccggtgccttat
gaccgtatcctggcatcccgtatgggcgcttacgccatcgaactgctgctgcagggccac
ggcggccgctgcgtcggcatccagaacgaaaaaatggtgcatcatgacatcatcgacgct
atcgaaaacatgaagcgtccgttcaaaggcgactggctggagtgcgcgaaaaagctctac
taa

DBGET integrated database retrieval system