KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_04162Help
Entry
ESA_04162         CDS       T00586                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:esa00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:esa00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4118992..4120314
Genome map
AA seq 440 aa AA seqDB search
MPTYFDQLERVRYEGPKTTNLLAFRHYNPDELVAGKRMEDHLRFAACYWHTFCWNGSDMF
GVGAFERPWQQAGDALSLAKRKADVAFEFFHKLNVPYYCFHDVDVSPEGASLKEYLNNFA
QMVEVLAQKQQESGVKLLWGTANCFTHPRYGAGAATNPDPEVFSWAATQVVTAMNATHQL
GGENYVLWGGREGYETLLNTDLRQEREQLGRFMQMVVEHKHKTGFRGTLLIEPKPQEPTK
HQYDYDAATVYGFLKQFGLEKEIKLNIEANHATLAGHSFHHEIASAIALGLFGSVDANRG
DPQLGWDTDQFPNSVEENALVMYEILKAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAM
DTMALSLKVAAKMLEEGELDKRVARRYAGWNGELGQQILKGQMTLAELAQYAEQHNLAPQ
HQSGHQEQLENLVNYYLFDK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgccgacttatttcgaccaacttgaacgtgtacgttatgaaggcccgaaaaccacgaat
ctcctggcatttcgccattacaatcctgacgagttggttgccggcaagcgtatggaagac
catctgcgtttcgctgcctgctactggcacacgttctgctggaacggctcggatatgttt
ggtgttggcgcgtttgaacgcccgtggcagcaagcaggcgatgcgctgagcctcgcgaaa
cgcaaagccgacgtggcctttgagtttttccataagctcaacgtgccttactactgcttc
catgacgttgacgtatcgccggaaggcgcgtcgctgaaggagtacctgaacaacttcgcc
cagatggtagaagtgctggcgcagaagcaacaggagagcggcgtgaagctgctgtggggc
accgccaactgctttacccacccgcgctacggcgcaggcgccgccaccaaccctgacccg
gaagtcttctcctgggcagccacgcaggtggtcaccgccatgaacgcgacccatcaactg
ggcggtgaaaactatgtgctgtggggcggacgtgaaggctacgaaacgctgctcaacacc
gatctgcgccaggagcgtgaacagcttggccgctttatgcagatggtggttgagcataaa
cataaaaccggttttcgcggtacgctgcttatcgagccaaaaccgcaggaaccgaccaaa
catcagtacgactacgacgcggcaaccgtgtatggcttcctgaaacagttcggccttgag
aaagagattaagcttaacatcgaggccaaccacgccacgcttgcgggccactctttccac
catgagattgccagcgccattgcgctcggtctgttcggttcggtagatgcgaaccgcggt
gacccgcagctcggctgggataccgaccagttcccgaacagtgtcgaagagaacgccctg
gtgatgtatgaaatcctcaaagcgggcggcttcacgaccggtgggctgaattttgacgcc
aaagtgcgccgtcagagcaccgataaatatgacctgttctatggtcatatcggcgcgatg
gatacgatggcgctgtcgctgaaagtcgcggcgaaaatgctcgaagagggcgaactggat
aaacgcgtcgcccgccgttatgccggctggaacggtgagcttggtcagcagatcctgaaa
gggcagatgacactggctgaactggcgcaatacgctgagcagcataatctggcaccgcag
catcagagcggacatcaggaacagctggaaaacctggtaaattattatctgtttgataag
taa

DBGET integrated database retrieval system