KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_04322Help
Entry
ESA_04322         CDS       T00586                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ESA_04322 (malQ)
Enzymes [BR:esa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     ESA_04322 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4291132..4293240
Genome map
AA seq 702 aa AA seqDB search
MESKRLDSSALAAGISPNYINAHGKPQAIGAETKRRLLEAMNPEAAPKAADKSPLPPVKV
VAKSRRMQLTPQGRGDYHWLLTSETGEQFSGNARGGEALTLPTKLDEGYHTLTLTRDDSR
WHCRLIVAPKRCYEPQALREGKKLWGACVQLYTLRSQNNWGIGDFGDLQAMLNEVGPRGG
AFIGLNPIHALYPANPESASPYSPSSRRWLNVIYIDVNAVEDFRRSDEAQAWWKLKSTQQ
ALKAARESQWVDYSTVTMLKLTALKMAWARFSTRGPDDDDVVAFRDFVARAGESLYWQAA
FDAIHAWQAQEDPMRWGWPAWPKAYQNTSSPEVQAFCKNRADEVDFYLWLQWLAYEQFAR
CWQTSQSHGMPIGLYRDLAVGVAEGGAETWCDRELYCLKASVGAPPDILGPLGQNWGLPP
MDPHVMQARAYEPFIELLRANMTNCGALRIDHVMSLLRLWWIPYGETADKGAYVQYPVDD
LLAILALESQRHRCMVIGEDLGTVPAEIVGKLRDSGVYSYKVLYFENEGGSRFRAPKRWT
SQAMAVATTHDLPTLRGYWESGDLTLGKTLGLYPDEEVLKGLYADRERAKQGLLESLHQH
GCLPKRAGHHAARMKMGATLNRALQRYIADSNSALLGLQPEDWLDMAQPVNVPGTSDQYK
NWRRKLTVGLEAMFADDTVNRLIKDLDKRRRAASAGKPAKRK
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaacgccttgactcctccgcccttgcggcggggattagccctaactacatc
aatgcgcacggcaaaccgcaggcgattggcgctgagaccaaacggcgtttgctggaagcg
atgaacccggaggccgcgccgaaagcggccgataaatcgccgctgccgccggtaaaagtg
gtggcgaagagccgccgtatgcagttaacgccgcagggccgcggcgattaccactggttg
ctcaccagcgaaaccggcgagcagtttagcggcaacgcgcgcggcggcgaggcactgacg
ctgccgacgaagcttgacgaggggtatcacacgctgacgctcacgcgtgacgacagccgc
tggcactgtcggcttattgtcgcgccgaagcgctgctatgagccgcaggcgctgcgtgag
ggtaaaaaactctggggcgcgtgcgtccagctttatacgctgcgctcgcaaaataactgg
ggcatcggggatttcggcgatctgcaagcgatgctgaatgaagtgggcccgcgcggcggc
gcgtttatcggtttaaacccgatccacgcgctttatccggcgaacccggagagcgcaagc
ccgtacagtccgtcttctcgccgctggcttaacgtcatttacatcgacgtgaacgcggtg
gaggatttcaggcgcagcgatgaggcgcaggcgtggtggaagcttaaatccacgcagcag
gcgctgaaagccgcccgggagtcgcagtgggtcgattactccaccgtgaccatgctcaag
ctcaccgcgctgaaaatggcctgggcgcgcttctccacgcgcggcccggatgatgacgat
gtggtggcgtttcgcgatttcgtggcgcgcgcgggcgaaagcctctactggcaggcggcg
ttcgacgccattcacgcctggcaggcgcaggaagatccgatgcgctggggctggcccgcc
tggccgaaagcgtatcagaacaccagcagcccggaagtgcaggcgttttgtaaaaaccgc
gctgatgaggtcgatttctacctctggctgcaatggctcgcgtatgagcagtttgcccgc
tgctggcagaccagtcagtcgcacggtatgccgatcgggctgtatcgcgatctggcggtc
ggcgtggcggaaggcggcgcggaaacctggtgcgaccgtgagctgtactgtctgaaagca
tcggttggcgcgccgccggatattctggggccgctcggtcagaactggggcctgccgccg
atggatccgcacgtgatgcaggcgcgcgcttacgagccgtttatcgaactgctgcgcgcc
aacatgacgaattgcggcgcactgcgcatcgaccatgtgatgtcgctgctgcgcctgtgg
tggatcccgtatggcgaaacggcggataaaggcgcgtatgtgcagtatccggtcgacgat
cttctggcgatcctcgcactcgaaagccagcgccaccgctgcatggtgatcggcgaagat
ctcggtacggttccggcggaaattgtcggcaagctgcgcgacagcggcgtctattcgtac
aaagtgctctactttgaaaacgaaggcggcagccgcttccgcgcgccaaagcgctggacg
tcgcaggcgatggcggtcgcgaccactcacgatctgccgacgctgcgcggctactgggaa
agcggcgatttaacgcttgggaaaacgctcgggctctatcccgacgaagaggtgttaaag
gggctgtacgccgatcgcgagcgggccaaacagggtttgctggagagcctgcaccagcat
ggctgcctgccgaaacgcgcagggcatcacgccgcgcgcatgaaaatgggcgccacgctg
aaccgcgcgctccagcgctatatcgccgacagcaacagcgcgctgctcggtctgcagccg
gaagactggctggatatggcgcagccggtcaacgtgccgggcaccagcgatcagtataaa
aactggcggcgcaagctcactgtcgggctggaagcgatgtttgctgatgacaccgtgaac
cggttgattaaagatctggataaacgtcgccgcgccgcgtcggcggggaagccagcaaaa
cgtaagtaa

DBGET integrated database retrieval system