KEGG   Enterobacter lignolyticus: Entcl_0031Help
Entry
Entcl_0031        CDS       T01342                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
esc  Enterobacter lignolyticus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:esc00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Entcl_0031
Enzymes [BR:esc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Entcl_0031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
32761..33681
Genome map
AA seq 306 aa AA seqDB search
MDIAVIGSNMVDLITYTNQMPKEGETLEAPAFKIGCGGKGANQAVAAAKLNSKVLMLTKV
GDDIFADNTIRNLESWGINTTYVEKVPCTSSGVAPIFVNANSSNSILIIKGANKFLSPED
IDRAAEDLKKCQLIVLQLEVQLETVYHAIEFGKKHGIEVLLNPAPALRELDMSYACKCDF
FVPNETELEILTGMPVDTYDRIRAAARTLVDKGLNNIIVTMGEKGALWMTRDQEVHVPAF
NVNAVDTSGAGDAFIGCFAHYYVQSGDVETAMKKAVLFAAFSVTGKGTQSSYPSIEQFNE
FLTLNE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgcggttatcggctccaatatggtggatctcatcacttacaccaaccagatg
cccaaagaaggggagaccctggaagcgccggcgttcaaaatcggctgtggcggtaaaggg
gcgaaccaggcggttgcggccgctaagcttaattccaaagtgctgatgctgaccaaagtc
ggcgacgatatttttgcggataacaccatccgcaacctcgagtcatgggggattaacacc
acctatgtggaaaaagtcccctgcaccagcagcggcgtggcgccaattttcgtcaatgcc
aactccagtaacagcattctgatcattaaaggcgcgaacaagtttctctctccggaggat
atcgatcgcgcggcggaagatttgaaaaaatgtcagctgatcgttctgcaactggaagtg
cagctggagacggtttaccacgccattgaatttggtaaaaagcatggcattgaggtgtta
ttaaatccggcgccagcattacgggaattagatatgtcatatgcctgtaaatgcgacttc
tttgtacccaatgaaaccgagctggaaatattaaccggcatgccggtggatacttacgat
cgtattcgcgctgccgctcgtacccttgtggataaagggctgaataatattatcgtcacc
atgggcgaaaagggcgcactgtggatgacgcgagaccaggaagtacatgtcccggcgttt
aacgtaaacgctgttgataccagcggcgcaggcgatgccttcatcggctgcttcgcccac
tattacgtccagagcggcgatgtggaaacagccatgaaaaaagccgtccttttcgccgct
ttcagcgttaccggaaaaggcacccaatcttcttatccgagcattgaacaatttaatgag
tttcttaccttaaacgaataa

DBGET integrated database retrieval system