KEGG   Enterobacter lignolyticus: Entcl_0085Help
Entry
Entcl_0085        CDS       T01342                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
esc  Enterobacter lignolyticus
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esc00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Entcl_0085
Enzymes [BR:esc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Entcl_0085
Exosome [BR:esc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Entcl_0085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(88536..90044)
Genome map
AA seq 502 aa AA seqDB search
MTEKKYIVALDQGTTSSRAVVMDHDANIVSVSQREFAQIYPKPGWVEHDPMEIWASQSST
LIEALAKADISSDQVAAIGITNQRETAIVWDKETGKPIYNAIVWQCRRTADICEQLKRDG
MEEYIRTATGLVVDPYFSGTKVKWILDHVEGSRERAKRGELLFGTVDTWLIWRMTQGRVH
VTDYTNASRTMLFNIHDLDWDDKMLQALDIPRAMLPEVRKSSEVYGQTNIGGKGGTRIPI
SGIAGDQQAALFGQLCVKEGMAKNTYGTGCFMLMNTGEKAVKSENGLLTTIACGPKGEVN
YALEGAVFMAGASIQWLRDEMKLINDAFDSEYFATKVKDTNGVYVVPAFTGLGAPYWDPY
ARGAIFGLTRGVNANHIIRATLESIAYQTRDVLEAMQADSGIRLHALRVDGGAVANNFLM
QFQADILGTRVERPEVREVTALGAAYLAGLAVGFWQNLDELQEKAVIEREFRPGIETTER
NVRYSGWKKAVHRALAWEDRDE
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagaaaaaatatatcgttgcgctggaccaggggactaccagctcccgcgccgtc
gttatggaccatgacgccaatatcgtcagcgtttcacagcgtgaattcgcacaaatttat
cctaagccaggctgggttgagcacgacccgatggagatctgggcatcgcaaagctcgacg
cttatcgaagcgctggcgaaagccgacatcagctccgatcaggtggcggctatcggtatt
accaaccagcgtgaaaccgccatcgtctgggataaagaaaccggcaaacccatttacaac
gccatcgtctggcagtgccgccgtacggcggacatctgcgagcagctcaagcgcgacggt
atggaagagtatatccgcaccgccacgggtctggtggtggacccgtacttctccggcacc
aaggtgaaatggattctggaccacgtggaaggctcccgcgagcgcgctaagcgcggcgag
ctgctgttcgggaccgtggacacctggcttatctggcgtatgacccagggccgcgtgcac
gtaaccgactacaccaacgcctcccgtactatgctgttcaacatccacgacctcgactgg
gacgataaaatgctccaggcgctggatatcccgcgtgcgatgctgccggaagtgcgtaaa
tcgtccgaagtgtatgggcagaccaacatcggcggtaaaggcggcacccgtattcctatc
tccggcatcgccggcgaccagcaggcggcgctgttcggccagctgtgcgtcaaggaaggg
atggcgaagaacacctacggcaccggctgctttatgctgatgaacaccggcgagaaggcc
gtgaagtccgaaaacgggcttttgaccaccatcgcctgcggcccgaaaggggaagtgaac
tacgcgctggaaggcgccgtgttcatggcgggcgcgtctattcagtggctgcgtgacgag
atgaagctcatcaacgacgcattcgattccgagtacttcgccaccaaggtcaaagatacc
aacggcgtgtacgtcgttccggcctttaccggtcttggcgcgccgtactgggacccgtat
gcccgcggcgccattttcggcctcacccgcggcgtaaatgccaaccacatcattcgcgcg
acgcttgagtccatcgcctaccagacccgcgacgtgctggaagcgatgcaggccgattcc
ggcattcgcctgcacgccctgcgcgtggacggcggcgcggtggcgaacaacttcctgatg
cagttccaggccgatatcctcggcacccgcgtcgagcgtccggaagtacgtgaagtgacg
gcgctgggcgcagcttacctggccggtctggccgtcggcttctggcagaatctggacgag
ctgcaggagaaagcggtgattgagcgcgagttccgcccgggtatcgaaaccaccgagcgc
aacgtacgctacagcggctggaaaaaagcggtacaccgcgcgctggcgtgggaagatcgc
gacgagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system