KEGG   Enterobacter lignolyticus: Entcl_0092Help
Entry
Entcl_0092        CDS       T01342                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
esc  Enterobacter lignolyticus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:esc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Entcl_0092
   01230 Biosynthesis of amino acids
    Entcl_0092
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Entcl_0092
   00051 Fructose and mannose metabolism
    Entcl_0092
   00562 Inositol phosphate metabolism
    Entcl_0092
Enzymes [BR:esc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Entcl_0092
Exosome [BR:esc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Entcl_0092
  Exosomal proteins of bladder cancer cells
   Entcl_0092
  Exosomal proteins of melanoma cells
   Entcl_0092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(96643..97410)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVNELVANLRKELAGVTGCAVAIAPPDMYLDLAKHAADGSHIV
LGAQNVDVNLSGAFTGETSAEMLKDIGAKYIIIGHSERRTYHKESDEFIAKKFAVLKEQG
LIPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFVGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKADASVAEQVIIQYGGSVNAANAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAEAAKQA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggtaaac
gagctggttgctaacctgcgtaaagagctggctggcgtgaccggctgtgcggtcgctatc
gcgccgccggacatgtacctggatctggctaaacatgccgcagacggcagccacatcgta
ctgggtgcgcagaacgttgacgttaacctgtccggcgcgttcaccggtgaaacctccgct
gaaatgctgaaagatatcggtgcgaaatacatcatcatcggtcactctgagcgtcgtact
taccacaaagaatccgacgaattcatcgctaaaaaattcgccgtgctgaaagagcagggt
ctgattccggttctgtgcatcggtgaaaccgaagcagaaaacgaagcgggcaaaaccgaa
gaagtgtgcgcacgccagattgacgcggtcctgaaaactcagggcgcggcggcgttcgtt
ggcgcggttatcgcttacgagccagtatgggctatcggcaccggcaaatcagcaacgcct
gcgcaggcacaggcggttcacaaattcatccgtgaccacattgccaaagctgacgccagc
gtcgctgagcaggtcatcatccagtacggcggttccgtaaacgcggctaacgctgctgag
ctgttcacccagccggacatcgacggcgcgctggttggcggcgcatccctgaaagcggac
gctttcgccgttatcgttaaagcagcagaagcggctaaacaggcgtaa

DBGET integrated database retrieval system