KEGG   Enterobacter cloacae SCF1: Entcl_0177Help
Entry
Entcl_0177        CDS       T01342                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
esc  Enterobacter cloacae SCF1
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:esc00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:esc00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
184809..186131
Genome map
AA seq 440 aa AA seqDB search
MQAYFDQLERVRYEGPKTQNPLAFRHYNPDELVLGKRMEDHLRFAACYWHTFCWNGADMF
GVGSFDRPWQQPGEAIALAKRKADVAFEFFHKLNVPYYCFHDVDVSPEGATLKEYLNNIA
QMVDVLAEKQQQSGVKLLWGTANCFTNPRYGAGAATNPDPEVFSWAAAQVVTAMNATHQL
GGENYVLWGGREGYETLLNTDLRQEREQIGRFMQMVVEHKHKIGFRGTLLIEPKPQEPTK
HQYDYDVATVYGFLKQFGLEKEIKVNIEANHATLAGHSFHHEIASAIALGVFGSVDANRG
DAQLGWDTDQFPNSVEENALVMYEIIKAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAM
DTMALALKVAARMIEDGELDKRVARRYAGWNGELGQQILKGQMSLAEIAKYAEQHSLAPQ
HHSGHQELLENLVNHYLFDK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcttatttcgatcaactcgaacgtgttcgttatgaaggcccgaaaacgcaaaat
ccgctggcgtttcgccactacaacccggatgaactggtgcttggcaagcgcatggaggat
cacctgcgttttgccgcctgctactggcacaccttctgctggaacggagcggatatgttc
ggcgtggggtcattcgatcgcccgtggcagcagcccggcgaggcgattgccctggcgaag
cgtaaagccgacgtggcctttgagttctttcacaagctgaacgtgccgtactactgcttc
catgacgtcgacgtttcgccggaaggcgccacgctgaaagagtatctgaataacattgcg
cagatggttgatgtgctggcggaaaaacagcagcaaagcggcgtgaagctgctgtggggc
accgcgaactgctttaccaacccgcgctatggcgccggtgcggccaccaacccggacccg
gaagtcttcagctgggcggcggcccaggtggtgaccgccatgaacgccacccatcagctg
ggcggggaaaactacgtgctgtggggcggccgcgaagggtatgaaacgctgctgaatacc
gacctgcgccaggaacgcgagcagattggccgcttcatgcagatggtggtcgagcataag
cacaagattggttttcgcggtacgctgttgattgagccgaagccgcaggagccgaccaag
caccagtacgactatgacgtcgccaccgtgtacggcttcctgaagcagttcggcctggaa
aaagagatcaaagtgaacatcgaagcgaaccacgcgacgctcgccggccactcgttccat
catgaaatcgcctcggcgattgcgctgggcgtgtttggttcggtggatgccaaccgcggc
gacgcgcagctcggctgggataccgaccagttcccgaacagcgtagaagaaaacgcgctg
gtgatgtatgaaatcatcaaagcgggcgggttcaccaccggcgggctgaacttcgacgcc
aaggtccgtcgccagagcaccgataaatacgatctgttctacggccatattggcgcgatg
gacacgatggcgctggcgctgaaggtggcggcgcggatgattgaagacggcgagctggat
aaacgcgtggcgcgccgctatgcgggctggaatggtgagcttgggcagcaaattctcaaa
ggccagatgtcgctggctgagattgcgaagtacgctgaacagcatagcctggcgccgcag
caccacagcggtcatcaggagctgctggaaaacctggtcaatcattacctgttcgacaag
taa

DBGET integrated database retrieval system