KEGG   Enterobacter lignolyticus: Entcl_0308Help
Entry
Entcl_0308        CDS       T01342                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
esc  Enterobacter lignolyticus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:esc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Entcl_0308
Enzymes [BR:esc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Entcl_0308
Exosome [BR:esc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Entcl_0308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
332327..334513
Genome map
AA seq 728 aa AA seqDB search
MSDRIDRDVINALIAGHFADPFSVLGMHSTDAGLEVRALLPDATDVWVIEPKTGRKVGKL
ECLDSRGFFCGVLPRRKNPFRYQLAVMWHGQQNLIDDPYRFGPLLQEMDAWLLSEGTHLR
PYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDGRRHPMRLRAESGIWELFIP
GAQHGQLYKFEMIDAHGKLRIKADPYAFEAQMRPETASLICGLPEKVEQPESRRRANQFD
APISIYEVHLGSWRRHTDNNFWLSYRELADQLVPYAKWMGFTHLELMPVNEHPFDGSWGY
QPTGLYAPTRRFGTRDDFRYFINAAHAAGLNVILDWVPGHFPSDDFGLARFDGTELYEHS
DPREGYHQDWNTLIYNYGRREVANYLVGNALYWIERFGIDALRVDAVASMIYRDYSRKEG
EWIPNEHGGRENLEAIEFLRSTNRILGEQVPGAVSMAEESTDFAGVSRPASMGGLGFWFK
WNLGWMHDTLDYMKLDPVHRQYHHDKLTFGMLYNYTENFILPLSHDEVVHGKKSILDRMP
GDAWQKFANLRAYYGWMFAFPGKKLLFMGNEFAQGREWNHDSSLDWHLLEGGDNWHHGVQ
RLVRDLNHTYRHHKALHELDFESYGFEWLVVDDNERSVLAFVRRDRQGNEIIVISNFTPV
PRHHYRFGINQPGRWREEMNTDSTHYHGSNAGNGGAVQSDEIASHGRQHSLSLTLPPLST
LWLVREGE
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatcgtatcgatagagacgtgattaatgcccttattgccggccactttgcggac
ccattttccgtgcttggcatgcatagtaccgacgcaggactggaagtccgcgcactctta
cctgacgccaccgacgtgtgggtcattgagccgaaaaccgggcgtaaagtgggcaagctg
gagtgcctcgattcgcgtggtttcttttgcggcgtgctgccgcgtcgtaaaaaccctttc
cgctaccagctggccgtcatgtggcatggccagcagaacctgattgacgatccgtatcgc
tttggcccgctgctgcaggagatggacgcctggctgctgtcggaaggtacgcacctgcgg
ccgtacgaaacgctgggggcgcacgcggataccatggatggcgtgaccggcacccgcttc
tccgtctgggcgccaaacgcccgtcgcgtctccgtggtgggtcagttcaactactgggac
ggccgtcgtcatccgatgcgcctgcgcgcggagtccggcatctgggagctgtttatcccc
ggcgcgcagcacggccagctgtataagttcgaaatgattgatgcgcacggcaagctgcgc
atcaaggccgacccgtacgcctttgaagcgcagatgcgcccggaaaccgcctcgcttatc
tgcggactgccggagaaggtcgagcagccggagtcgcgccgcagggccaaccagttcgac
gcgccgatttccatttacgaggtgcatctcggctcctggcgccgccataccgacaacaac
ttctggctgagctaccgcgagctggcggatcagctggtgccctacgcgaagtggatgggc
ttcacccatctcgagctgatgccggttaacgagcatccgttcgacggcagctggggctat
cagcctaccgggctgtatgcgccgacgcgccgtttcggcacccgcgacgacttccgttac
ttcatcaacgccgcgcacgccgccgggcttaacgtcattcttgactgggtgccggggcat
ttcccctccgatgattttggcctggcgcgctttgacggcaccgagctgtacgagcacagc
gacccgcgcgaaggctatcaccaggactggaatacgcttatctataactacggtcgccgc
gaagtcgccaactatctggtgggcaacgcgctgtactggatcgaacgcttcggcatcgac
gccctgcgcgtggacgcggtggcgtcgatgatctaccgcgactacagccgcaaagagggc
gagtggatcccgaacgagcacggcgggcgtgaaaatctggaagctattgagttcctgcgc
agcaccaaccgcattcttggcgagcaggtgccgggcgcggtgagcatggcggaagagtcg
accgattttgccggcgtctcgcgcccggcgtcgatgggcggcctcggcttctggttcaag
tggaaccttggctggatgcacgacacgctcgactacatgaagctcgatccggtgcaccgt
cagtatcaccacgacaagctcaccttcggcatgctctacaactacaccgagaacttcatc
ctgccgctgtcgcacgacgaagtggtgcacggtaagaaatcgattctcgaccggatgccg
ggcgatgcgtggcagaagttcgccaacctgcgcgcctactacggctggatgttcgccttc
ccgggtaaaaagctgctgtttatgggcaacgaattcgcccagggacgcgagtggaatcat
gacagcagccttgactggcatctgctggagggcggggataactggcaccacggcgtacag
cgcctggtgcgcgacctcaaccacacctaccgtcaccataaagcgctgcacgagctggat
ttcgagtcgtacggctttgagtggctggtggtcgacgataacgagcgttcggtgctggcg
ttcgtgcgccgcgaccgccagggcaacgaaatcatcgtcatcagcaactttacgccggtg
ccgcgtcaccattaccgcttcggtattaaccagccgggccgctggcgcgaagagatgaac
accgattcgacgcactaccacggcagcaacgccggtaacggcggcgcagtgcagagcgat
gagatagcgagccacggccgccagcattcgctgtcgctgacgctgccgccgctgtccacc
ctgtggctggtgcgggagggggaatga

DBGET integrated database retrieval system