KEGG   Enterobacter cloacae SCF1: Entcl_0319Help
Entry
Entcl_0319        CDS       T01342                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
esc  Enterobacter cloacae SCF1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:esc00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
351135..353222
Genome map
AA seq 695 aa AA seqDB search
MESKRLDNAALAAGISPNYINAHGKPQSIGADTKRRLLDAMHHATQGRPAAVTPVPNVTV
FTHGKKMALAVEGHGEYQWLLTTEEGVLHQGVASGGKALNLPARLPEGYHSLTLTQQAHR
WHCRVIVAPERCYEPQALKQGEKLWGSCVQLYTLRSAHNWGIGDFGDLQAMLPEIARRGG
AFIGLNPIHALYPANPESASPYSPSSRRWLNVIYIDVNAVDDFRTSRAAQAWWQLPATQQ
ALRAAREAEQVDYTAVTRLKMTALRMAWEDFSARDDEPMAAFRRFVAQEGESLYWQAAFD
ALHAQQVKLDPLRWGWPAWPKALQDISSPQVRAFCEQHADEVDFFLWLQWLAWSQFAACW
QESQRHEMPIGLYRDLAVGVAEGGAETWCDRELYCLKASVGAPPDILGPLGQNWGLPPMD
PHVMVARAYEPFIELLRANMQNCGALRIDHVMSVLRLWWIPYGETADHGAYVQYPVDALL
SVLALESKRHQCMVIGEDLGTVPVEIVGKLRKSGVYSYKVLYFENDAGKTFRAPKAYPVQ
SMAVATTHDLPTLRGYWESGDLTLGKTLGLYPDEVVLRGLYQDREKAKQGLLNALHKYGC
LPKRVGRHASLMGMTPTLNRGMQRFIADSNSALLGLQPEDWLEMPEPVNIPGTSDQYPNW
RRKLSTSLEAMFADDRVNKLIKDLDKRRKALGKKR
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaaacgtctggataatgccgcgctggcggcgggcatcagcccgaactatatc
aatgcccacggcaaaccgcagtctattggtgccgacaccaaacggcgcttgctcgacgct
atgcaccacgccacccagggccgtccggcggcagttacgccggtacctaacgtgacggtg
ttcacccacgggaaaaagatggcgctggcggtagaggggcacggcgaataccagtggctg
ctgaccaccgaagagggcgtactgcaccagggggttgccagcggcgggaaggcgctcaac
ctgccggcccgtctgccggaaggctatcactccctgacgttgacccagcaggcgcatcgc
tggcactgccgggtcatcgtcgcgccggagcgctgctacgagccgcaggccctaaagcag
ggggagaagctgtggggcagctgcgtgcagctgtataccctgcgttcggcacataactgg
ggcatcggcgatttcggcgatctgcaggcgatgctgccggagattgcccgtcgcggcggc
gcttttatcggcctgaaccccatccatgcgctctatccggcgaacccggaaagcgccagc
ccctatagcccatcgtcccgccgctggctgaacgttatctacattgacgtcaacgccgtc
gacgattttcgcaccagccgcgccgcgcaggcgtggtggcagctccccgccacgcagcag
gcgctgcgcgcggcgcgggaggctgagcaggtcgattacaccgcggtgacccggctgaag
atgacggcgctgcgcatggcgtgggaagacttttccgcccgcgatgatgagccgatggcg
gcgtttcgccgctttgtggcgcaggagggcgaaagcctgtactggcaggcggcgtttgac
gccctgcacgcgcagcaggtgaagctcgacccgctgcgctgggggtggccggcgtggccg
aaggcgctgcaggacattagcagcccgcaggtgcgcgcgttttgcgaacagcacgccgac
gaggtggatttcttcctctggctgcagtggctggcctggagccagtttgccgcctgctgg
caggagagccagcggcatgagatgcccatcggcctgtaccgcgatcttgcggtcggcgtt
gcggagggcggcgctgagacctggtgcgaccgggagctgtactgcctgaaagcctccgtc
ggcgcgccgccggatatcctcggtccgctggggcaaaactgggggctgccgccgatggat
ccgcacgtgatggtcgccagagcctacgagccgtttatcgaactgctgcgcgccaatatg
caaaactgcggcgcgctgcgtatcgatcacgtcatgtcggtgctgcggctgtggtggatc
ccctacggtgaaacggcggaccacggagcgtatgtgcagtacccggtcgatgcgctgctg
tcagtccttgcgctggagagcaaacgccatcagtgcatggtgatcggcgaagatctgggc
accgtgccggtagagatcgtcggcaagctgcgtaagagcggcgtttattcctacaaggtg
ctgtatttcgaaaacgacgccgggaagaccttccgggcgccgaaggcgtatccggtccag
tcgatggcggtcgccaccacccatgacctgccgacgcttcgcggctactgggagagcggc
gatctgacgcttggcaaaacgctggggctctacccggacgaggtcgtgctgcgcgggctg
tatcaggacagggaaaaggcgaagcaggggcttttgaatgcgctgcacaaatacggctgc
ctgccgaaacgcgtcgggcgccacgcctcgctgatggggatgacccccacgcttaaccgc
gggatgcagcgctttattgctgacagcaacagcgccctgctggggctacagccggaagac
tggctggagatgccggagccggtgaacattcccggcaccagcgatcagtacccgaactgg
cgtcgcaaactttccacctcgctggaggcgatgttcgccgatgaccgggtcaacaagctg
attaaggatctggataagcgcaggaaggcattgggtaagaagcggtga

DBGET integrated database retrieval system