KEGG   Enterobacter lignolyticus: Entcl_0624Help
Entry
Entcl_0624        CDS       T01342                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12111  
evolved beta-galactosidase subunit alpha [EC:3.2.1.23]
Organism
esc  Enterobacter lignolyticus
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Entcl_0624
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Entcl_0624
Enzymes [BR:esc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Entcl_0624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(650602..653694)
Genome map
AA seq 1030 aa AA seqDB search
MNRWENLQLTHENRLPPRAYFFSYDSTAQARTFARETSSRFLSLSGQWNFRFFSNPLLVP
EAFTSQYISGWEPITVPGMWQMEGHGQLQYTDEGFPFPIDVPYVPTDNPTGAYQRTFTLS
EGWQGKQTLIKFDGVETYFEVYVNGQYIGFSKGSRLTAEFDISAAVKTGDNLLCVRVMQW
ADSTYIEDQDMWWSAGIFRDVYLVGKTPLHVQDFTVRTDFNDDYRDATLSCQLQLENLAA
RPDAATLEYVLFDGEQALYQGKTGSIAVDQTAHAHFAIDVKAPQQWSAENPYLYHLVMTL
KNAAGEVLEIIPQRVGFRDIKVRDGLFYINNRYVMLHGVNRHDNDHLKGRAVGMERVEKD
LQLMKQHNINSVRTAHYPNDPRFYELCDIYGLFVMAETDVESHGFANVGNLSAITDDPAW
EHIYVERIVRHVHAQKNHPSIVIWSLGNESGYGCNIRAMYHATRALDDTRLVHYEEDRDA
EVVDIISTMYTRVPLMNEFGEYPHAKPRIICEYAHAMGNGPGGLTEYQNVFYQHDSIQGH
YVWEWCDHGIQATDDSGAVWYKYGGDYGDYPNNYNFCLDGLIFSDQTPGPGLREYKQVIA
PVKVQATDLARGELRVDNKLWFSTLDDYTLRVEVRAEGETLSSEVLKVRDLAPNSGREVR
ITMPALDEREAFVNVMVTKDSRTPYSDANHAIAVYQFPLKARTAVKTPLINASATPLSVA
DDRLSYTISGHNFRAVFSKVSGKLTHWQVNGVDQVTREPKINFFKPMIDNHKQEYEGLWQ
PAHLQIMQEHLREFHTERQGDTVIVTTRSIIAPPVFDFGMRCTYRWQITPQGHINVELQG
ERYGDYPHIVPCIGFMLGINGEFEQVNYYGRGPGENYADSQQCNIIDIWRTTVDEMFVNY
PFPQNNGNRQHVRWASFTSRHGNGLLVVPRRPINVSAWHYTAENIHAAQHCNELQRSDDI
TLNLDDQLLGLGSNSWGSEVLDSWRVWLKPFNYGFTLLPLEGGCSTSQVLANHAFGADFF
SPVSHSEAEK
NT seq 3093 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgctgggaaaatcttcagctcactcatgaaaacaggctgccgccgcgcgcgtac
ttcttctcgtacgattcgacggcgcaggcgcggaccttcgcccgcgaaaccagcagccgc
tttttgtccctcagcggacaatggaactttcgctttttcagcaacccgctgctggtgccc
gaggcgtttacctcgcagtacatcagcggctgggagccgattaccgtgccgggcatgtgg
cagatggaaggccacggccagctgcagtataccgatgaaggcttcccgttcccgattgac
gttccctatgtcccgacggataacccaaccggcgcctatcagcgcaccttcaccctcagc
gaaggctggcagggcaagcaaaccctgattaaattcgacggtgtcgaaacctattttgag
gtctacgttaacggccagtacatcggctttagcaaaggcagccgtctgacggcggaattc
gatatcagcgccgcggtgaaaaccggcgataacctgctgtgcgtccgggtcatgcagtgg
gcggattcgacctacattgaagatcaggacatgtggtggtcggcgggcattttccgcgac
gtttacctggtcgggaaaaccccgctgcacgtgcaggatttcaccgtccgcaccgacttt
aacgacgactaccgcgatgcgaccctctcctgccagctgcagctggaaaacctcgccgca
cggcccgacgcggccaccctggagtacgttctgttcgacggcgaacaggcgctgtatcag
gggaaaaccggcagcatcgcggtagaccagacggcgcacgcccacttcgccatcgacgtg
aaagcgccgcagcagtggtcagcggaaaacccgtacctctatcacctggtgatgacgctg
aaaaacgcagcgggcgaggttctggaaatcatcccgcagcgcgtgggctttcgcgacatc
aaagtgcgcgatgggctgttttatatcaacaaccgttacgtcatgctgcacggcgtgaac
cgccacgataacgaccatctgaaagggcgcgccgtcggcatggagcgggtggaaaaggac
ctgcagttgatgaagcagcacaacatcaactcagtgcgtaccgcccattacccgaacgat
ccccgcttctacgagctgtgcgatatttatggcctgttcgtgatggcggaaaccgacgtg
gagtcccacggtttcgccaacgtcggcaatctgagcgccattaccgacgacccggcctgg
gagcatatctacgtcgagcgcatcgtgcgccacgtccatgcacagaaaaaccatccgtcg
atcgtcatctggtcgctgggcaatgagtccggctacggctgcaatatccgcgcgatgtac
cacgccaccagggcgctggacgatacccggctggtgcattatgaagaggaccgcgacgcc
gaagtggtggatatcatctccacgatgtatacccgcgtgccgctgatgaacgagtttggc
gagtacccgcacgccaagccgcgcattatctgcgaatatgcccacgccatgggcaacggc
cccggcgggctgacggaataccagaacgtcttttaccagcatgacagcattcagggccac
tacgtgtgggagtggtgcgatcacggcattcaggcgaccgacgacagcggcgcggtgtgg
tacaagtacggcggcgactacggcgactacccgaacaactataacttctgcctcgacggg
ctgattttctccgaccagaccccggggccggggctcagggagtacaaacaggtcatcgcg
ccggtgaaggttcaggccacggatcttgcccgcggcgagctgcgcgtcgacaacaagctg
tggttctctaccctggacgactacaccctgcgcgtggaagtccgcgccgaaggcgaaacg
ctctccagcgaagtgctaaaggtgcgcgacctggcgccgaacagcggccgcgaggtccgg
attacgatgcccgcgctcgacgagcgcgaagcgttcgttaacgtgatggtgacgaaggat
tcccgcacaccgtacagcgacgccaaccacgccatcgccgtctatcagttcccgttgaaa
gcgcgaacggcggtaaaaacgccgcttattaacgccagcgccacgccgctgagcgttgcc
gacgatcgcctgagctacaccatcagcggccacaacttccgcgcggtgttctccaaagtc
agcggcaagctgacgcactggcaggttaacggcgtcgatcaggtcacccgcgagccgaag
atcaacttcttcaagccgatgattgataaccacaagcaggaatacgaggggctgtggcaa
ccggcgcacctgcaaatcatgcaggagcacctgcgcgaatttcacaccgagcgccagggc
gataccgttatcgttaccacccgcagcatcattgcgccgccggtgtttgatttcggcatg
cgctgcacctaccgctggcagataacgccgcagggacacatcaacgtggagctgcagggc
gaacgctacggcgactacccgcacatcgtcccgtgcatcggctttatgctgggcatcaac
ggcgagtttgagcaggtgaactactacggccgcggcccgggcgaaaactacgccgacagc
cagcagtgcaacattatcgacatctggcgcaccaccgtagacgagatgttcgtgaactac
ccgttcccgcagaacaacggcaaccgccagcacgtccgctgggcctcgttcaccagccgt
cacggcaacggcctgctggtggtcccgcgcaggccgattaacgtcagcgcctggcactat
accgcggaaaatatccacgccgcccagcactgcaacgagctgcagcgcagcgacgacatc
acgctgaacctcgacgaccagctgctgggcctcggctccaactcctggggcagcgaggtg
ctggacagctggcgcgtgtggctcaaaccgttcaactacggctttacgctgctgccgttg
gagggcggatgcagcacctcgcaggtgctggcgaaccacgcgttcggcgccgatttcttt
tcccccgtttcgcacagcgaggctgaaaaatga

DBGET integrated database retrieval system