KEGG   Enterobacter lignolyticus: Entcl_0860Help
Entry
Entcl_0860        CDS       T01342                                 

Definition
Disulfide bond isomerase, DsbC/G-like protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
esc  Enterobacter lignolyticus
Brite
Enzymes [BR:esc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Entcl_0860
Secretion system [BR:esc02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Entcl_0860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
894843..895556
Genome map
AA seq 237 aa AA seqDB search
MKKGLLTFSLLAAALSGAAHADDAAIRQSLAKLGVQSTDIQPAPVAGMKTVLTNSGVLYV
TDDGKHVIQGPMYDVSGAQPVNVTNTLLVGKLNALEKEMIVYKAPQEKHVITVFTDITCG
YCHKLHEEIKDYNALGITVRYLAFPRQGVQSQAEQDMKAIWCAKDRNKAFDDAMSGKGVQ
AASCNIDIANHYALGVQFGVNGTPAIVLNDGYVVPGYQGPKEMKAFLDEHQKQTSGK
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggtttactgacattctctttgctggccgccgcgctgtccggcgccgcgcac
gctgacgatgccgccattcgccagtcgctggctaaactgggtgtgcagagcacggatatt
caacctgcgccggttgccggtatgaaaacggtgctgaccaacagcggcgtgctgtacgtg
accgacgacggtaaacacgtcattcaggggccgatgtacgacgtcagcggcgctcagccg
gtgaacgtcaccaacacgctgctggttggcaagctgaacgcgctggaaaaagagatgatc
gtctacaaggcgccgcaggaaaaacacgtcattaccgtgtttaccgacatcacctgcggc
tattgccacaagctgcatgaagagataaaggactataacgcgctggggatcaccgtacgc
tatctggcgttcccgcgtcagggcgtgcagagccaggcggagcaggatatgaaggctatc
tggtgcgcgaaagatcgcaataaagcctttgacgacgccatgagcggcaaaggcgtccag
gcggcgagctgcaatatcgatatcgccaaccactacgcgctgggcgtgcagtttggcgtc
aacggcaccccggccatcgttcttaacgatggctacgtggtgccaggctatcagggaccg
aaggaaatgaaagcgttcctggacgaacatcagaaacagaccagcggtaagtaa

DBGET integrated database retrieval system