KEGG   Enterobacter lignolyticus: Entcl_0911Help
Entry
Entcl_0911        CDS       T01342                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
esc  Enterobacter lignolyticus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:esc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Entcl_0911
Enzymes [BR:esc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Entcl_0911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
950524..952362
Genome map
AA seq 612 aa AA seqDB search
MALAALLMEAQQLKLLRPLDVQFALTVAHNDGPAVMLAAALLSHDAGEGHVCLPLSRLRP
EAWSGTKSPTLWPQLFALAGSEDERLRQLQASPAVSDGDTPAPMVLNEGRLYLNRMWRSE
QAIARFFNQPQPLPLADEATIAQVLADLFPASHEVDWQKVAAAVALTRRISVISGGPGTG
KTTTVARLLAALIRLSGDRRCRIRLAAPTGKAAARLTESLGAALRKLPLTEQQKAMLPTE
AGTLHRLLGAQPGSQRMRYHAGNPLHLDVLVVDEASMIDLPMMARLIDALPPHARVIFLG
DRDQLASVEAGAVLGDVCAWVNDGYTHARALELSRLTGTPVPAGRGELAGQLRDSLCLLQ
KSYRFDESSGIGQLAKAVNEGRAEAMRAAFRHGFTDISLSALRTAPEYEAMLEDARAGYD
DYLQLLKAKAEPEAILAAFGHYQLLCALREGPYGVSGLNTQFEQLLARKRQIAMLRHSPW
YEGRPVMIARNDSALGLFNGDIGVALERGSGLRVWFPMPDGRIKSVQPSRLPEHDTAWAM
TVHKSQGSEFAHAALILPAQPTPLVTRELVYTAITRAKTRLSMYADEKLLAQAITVRTER
RSGLAALFGRQE
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atggcgctggccgcattattgatggaagcgcagcagctgaagctgctgcgcccgcttgac
gtccagtttgcgctgaccgttgcgcacaacgacggtccggcggtgatgctggccgccgcg
ctgctcagccatgacgccggggaagggcacgtgtgcctgccgctgtcgcgcctgcgcccc
gaggcctggagcggtacgaaatcaccgacgctctggccgcagctgtttgcgctggcgggg
agcgaggatgagcggctgcgccagctgcaggcgtcgcctgcggtaagcgacggcgatacg
ccagcgccgatggtgctcaacgaggggcgcctgtacctcaaccgtatgtggcgcagcgaa
caggcgatcgcccgttttttcaatcagccccagccgctgccgctggcggatgaggcgacg
atagcgcaggtgctggcggatctgtttccggcaagccatgaggttgactggcagaaagtg
gcggcggcggtggcgctgacccggcgcatttcggtgatttccggcggcccgggaacgggt
aagaccaccaccgtcgccaggctgctggcggcgctgatccgtctgtccggcgatcggcga
tgccgtatccgccttgccgcgccaaccggcaaagcggcggcgcgcctgactgagtcgctc
ggcgcggcgctgcgcaaactgccgctgaccgaacagcaaaaagcgatgctgccgacggag
gcggggacgctgcaccgtctgctgggcgcccagcccggcagccagcgcatgcgctatcac
gcgggcaacccgctgcacctcgatgtgctggtggtcgatgaggcctccatgattgacctg
ccgatgatggcgcggctgattgacgcgctgccgccccatgcccgggttatctttcttggc
gatcgcgatcagctggcctccgtcgaagctggcgcggtgctgggcgacgtctgcgcctgg
gtgaacgacggttacacccatgcgcgcgcgctggagctcagccgtctgaccggaacgccg
gtgccggctggacgcggcgaactggccggtcagcttcgcgacagcctgtgcctgctgcaa
aaaagctaccgctttgacgaaagctccggtatcggccagctggcgaaagcggtgaatgag
gggcgcgctgaggcaatgcgcgctgcatttcggcacggatttaccgatatttcgctgagc
gccctgcgcaccgcgccggagtatgaggcgatgctggaagacgcgcgggcaggctatgac
gactacctgcagctgctgaaagcgaaggcggagccggaggcgattctggcggcgtttggt
cactatcagctgctgtgcgccctgcgcgaaggcccctatggcgtaagcggactcaatacc
cagtttgagcagctgctggcgcgaaaacggcagattgccatgctgcggcactcgccgtgg
tatgagggacggccggtcatgatcgcccgcaacgacagcgcgctggggttattcaacggc
gatattggcgtggcgctcgagcgcggcagcgggctgcgggtgtggtttccgatgccggac
ggccgcataaagtccgtgcagccgagccgcctgccggagcatgataccgcgtgggccatg
acggtgcataagtcccagggctcggagtttgcgcatgcggcgctgatcctgcccgcgcag
ccaacgccgctggtgacccgtgagctggtgtataccgccatcacgcgcgctaaaacgcgg
ctgtcgatgtacgcggatgaaaaactgctggcgcaggctatcaccgtgcgcaccgaacgg
cgcagcgggctggcggcgctgtttggccgtcaggaataa

DBGET integrated database retrieval system