KEGG   Enterobacter lignolyticus SCF1: Entcl_0957Help
Entry
Entcl_0957        CDS       T01342                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
esc  Enterobacter lignolyticus SCF1
Brite
Enzymes [BR:esc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Entcl_0957
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_31 Methyltransf_25 Methyltransf_23 Methyltransf_11 Methyltransf_32 NodS CMAS GCD14 MTS DREV Methyltr_RsmB-F
Motif
Other DBs
NCBI-ProteinID: ADO47229
UniProt: E3G5U4
Position
1002547..1003173
Genome map
AA seq 208 aa AA seqDB search
MVSKRVQSLLNQLRNQGILNEHVLEAIAEVPREKFIDEAFEHKAWENVALPIGQGQTISQ
PYMVARMTELLELTPESRVLEIGTGSGYQTAILAHLVHHVCSVERIKSLQWQARRRLKQL
DLHNVSTRHGDGWQGWQAKAPFDAIIVTAAPPEIPQALMSQLAEGGILVLPVGDEQQVLQ
RIRRRGSEFIIDTVEAVRFVPLVKGELA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggtaagtaaacgcgtacaaagtcttcttaatcaactacgtaaccagggcattctcaac
gagcatgtcctggaagcgattgccgaggttccgcgggaaaagtttattgatgaagccttt
gaacacaaggcatgggaaaacgtcgcgctgccgataggccagggacagacgatttctcag
ccctatatggtggcgcggatgaccgagctgctggagctgacgccggagtcccgggtgctg
gaaatcggcaccgggtcgggttatcagacggcgattctggcgcatctggtgcaccatgtt
tgctccgtcgaacgcatcaaaagcctgcagtggcaggcgcgtcggcgtctcaaacagctg
gatttacataatgtttcaactcgccatggcgatggatggcagggatggcaggcaaaagcg
ccatttgatgccattattgtcacggcggcgccgccggaaattccgcaggcgctgatgtcg
cagctggcggaaggcggcatccttgttttacccgtgggagacgagcagcaggttttgcag
cgcattcgtcggcgggggagcgagtttattattgataccgtggaggccgttcgctttgta
ccgctggtcaaaggcgagctggcgtaa

DBGET integrated database retrieval system