KEGG   Enterobacter lignolyticus: Entcl_0991Help
Entry
Entcl_0991        CDS       T01342                                 

Definition
glycoside hydrolase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
esc  Enterobacter lignolyticus
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:esc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Entcl_0991
Enzymes [BR:esc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     Entcl_0991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1037256..1038680)
Genome map
AA seq 474 aa AA seqDB search
MSSFPQGFLWGGALAANQSEGAWREGGKGLTTVDTIPHGAGRMPVKLGLEKRFTLRDDEF
YPSHQAIDFYHRYKEDIALMAEMGFTVFRTSIAWSRIYPKGDELTPNPEGIAFYRALFEE
CKKYNIEPLVTLCHFDVPMHLVVEYGSWRNRKMVEFFTRYARTCFEAFDGLVKYWLTFNE
INIMLHSPFSGAGLVFEEGENQDQVKYQAAHHELVASALATRIAHEVNPQNQVGCMLAGG
NFYPWSCKPEDVWAALEKDRENLFFIDVQARGAYPAYSARVFREKGINIEKAPEDDDILK
NTVDFVSFSYYASRCASAEMNSQNTSAANVVKSLKNPYISASEWGWGIDPLGLRITMNMM
YDRYQKPLFLVENGLGAKDVVEANGEINDDYRITYLREHIQAMGEAIADGVPLIGYTTWG
CIDLVSASTGEMSKRYGFVYVDRDDAGNGTLDRKRKKSFWWYKKVIASNGADLA
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagttttccgcaaggatttttatggggcggcgcactggccgccaaccagtctgaa
ggcgcatggcgggagggcggaaagggcttaaccaccgtcgatactatcccgcacggcgcc
gggcgcatgccggtgaagctgggcctggaaaagcgctttaccctgcgcgacgacgagttt
taccccagccatcaggccatcgatttctatcatcgctataaggaagatatcgcgctgatg
gcggagatgggatttacggtctttcgcacctccatcgcctggagccgcatctacccgaaa
ggcgacgagctgacgccaaacccggagggtattgcgttttaccgcgcgctgttcgaagag
tgcaagaaatacaacattgagccgctggtcacgctctgccacttcgacgtgccgatgcat
ctggtggtggagtacggctcctggcgcaaccgcaaaatggttgagtttttcacccgctat
gcccgcacctgcttcgaggctttcgacgggctggtgaaatactggctcacctttaatgaa
atcaacatcatgctgcacagccccttctccggcgccgggctggtgttcgaagagggcgaa
aaccaggatcaggtgaaataccaggccgcgcaccacgagctggtggccagcgcccttgcg
acccgcatcgcccacgaggtgaacccgcaaaaccaggtgggctgcatgctggcgggcggt
aatttttacccctggtcctgcaagccggaagacgtctgggcggcgctggaaaaagaccgg
gaaaacctgttctttatcgacgtgcaggcgcgcggcgcctacccggcttactccgcccgc
gtatttcgtgaaaaagggataaacatcgaaaaagcgccggaagatgacgacatcctgaaa
aacaccgtcgatttcgtctcctttagctactatgcctcccgctgcgcctcggcggagatg
aacagtcagaacaccagcgcggccaacgtagtgaaatcgctgaaaaacccgtacatcagc
gccagcgaatggggctggggcatcgacccgctcggcctgcgcatcaccatgaatatgatg
tatgaccgctatcagaagccgctgtttctggtggaaaacgggctgggcgcgaaggacgtg
gtggaggccaacggcgagatcaacgacgactaccgtatcacctatctgcgcgagcatatc
caggcgatgggcgaggccattgccgacggcgtaccgcttatcggctataccacctggggc
tgtatcgacctggtgtcggcctcgaccggtgagatgagcaagcgctacggctttgtgtac
gtcgatcgcgacgacgcgggcaacggtacgctggacagaaaacgcaagaagtcgttctgg
tggtataagaaggtgattgccagtaacggggcggacctggcgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system