KEGG   Enterobacter lignolyticus: Entcl_1183Help
Entry
Entcl_1183        CDS       T01342                                 

Definition
pyridoxal phosphate biosynthetic protein PdxJ (EC:2.6.99.2)
Orthology
K03474  
pyridoxine 5-phosphate synthase [EC:2.6.99.2]
Organism
esc  Enterobacter lignolyticus
Pathway
Vitamin B6 metabolism
Metabolic pathways
Module
Pyridoxal biosynthesis, erythrose-4P => pyridoxal-5P
Brite
KEGG Orthology (KO) [BR:esc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Entcl_1183
Enzymes [BR:esc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.99  Transferring other nitrogenous groups
    2.6.99.2  pyridoxine 5'-phosphate synthase
     Entcl_1183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1229811..1230542
Genome map
AA seq 243 aa AA seqDB search
MAELLLGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRI
LRQTLDTRMNLEMAVTEEMLAIACETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC
KRLADAGIQVSLFIDADDEQIKAAAEVGAPYIEIHTGCYADAETEDAQAKELARIARAAT
YAASLGLKVNAGHGLTYHNVKAIAALPEMHELNIGHAIIGRAVMSGLKEAVAEMKRLMLE
ARG
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattactgttaggcgtcaacattgaccacattgctactttacgtaacgcgcgc
ggaacggcgtatcctgacccggtgcaggcggcgtttatcgccgagcaggccggcgcagac
ggtatcaccgtgcatttacgcgaagatcgccgccatattaccgatcgcgatgtgcgcatt
ttgcgccagacgctcgatacccgcatgaacctggagatggcggtcaccgaagagatgctg
gctatcgcctgtgaaaccaaaccgcatttctgctgcctggtgccggagaagcgtcaggaa
gtgaccaccgagggcggtctggacgtggccggccagcgcgataaaatgcgcgacgcctgc
aaacgcctggcggatgccggtattcaggtatcgctgtttatcgatgccgatgacgagcag
atcaaagccgcagccgaagtaggcgccccgtatatcgaaatccataccggctgctatgcc
gatgccgaaacggaagacgcgcaggctaaggagctggcgcgtatcgccagagccgcaacc
tacgccgcaagcctggggctgaaggtaaatgccggtcacggcctgacctaccataacgtc
aaagctattgccgcgctgccggaaatgcatgagctgaacatcggccatgcgattatcggc
cgcgcggtgatgagcggcctgaaagaggcggttgctgagatgaagcgcctgatgctggaa
gcgcgcgggtaa

DBGET integrated database retrieval system