KEGG   Enterobacter cloacae SCF1: Entcl_1183Help
Entry
Entcl_1183        CDS       T01342                                 

Definition
pyridoxal phosphate biosynthetic protein PdxJ (EC:2.6.99.2)
Orthology
K03474  
pyridoxine 5-phosphate synthase [EC:2.6.99.2]
Organism
esc  Enterobacter cloacae SCF1
Pathway
Vitamin B6 metabolism
Metabolic pathways
Module
Pyridoxal biosynthesis, erythrose-4P => pyridoxal-5P
Class
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:esc00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1229811..1230542
Genome map
AA seq 243 aa AA seqDB search
MAELLLGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRI
LRQTLDTRMNLEMAVTEEMLAIACETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC
KRLADAGIQVSLFIDADDEQIKAAAEVGAPYIEIHTGCYADAETEDAQAKELARIARAAT
YAASLGLKVNAGHGLTYHNVKAIAALPEMHELNIGHAIIGRAVMSGLKEAVAEMKRLMLE
ARG
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattactgttaggcgtcaacattgaccacattgctactttacgtaacgcgcgc
ggaacggcgtatcctgacccggtgcaggcggcgtttatcgccgagcaggccggcgcagac
ggtatcaccgtgcatttacgcgaagatcgccgccatattaccgatcgcgatgtgcgcatt
ttgcgccagacgctcgatacccgcatgaacctggagatggcggtcaccgaagagatgctg
gctatcgcctgtgaaaccaaaccgcatttctgctgcctggtgccggagaagcgtcaggaa
gtgaccaccgagggcggtctggacgtggccggccagcgcgataaaatgcgcgacgcctgc
aaacgcctggcggatgccggtattcaggtatcgctgtttatcgatgccgatgacgagcag
atcaaagccgcagccgaagtaggcgccccgtatatcgaaatccataccggctgctatgcc
gatgccgaaacggaagacgcgcaggctaaggagctggcgcgtatcgccagagccgcaacc
tacgccgcaagcctggggctgaaggtaaatgccggtcacggcctgacctaccataacgtc
aaagctattgccgcgctgccggaaatgcatgagctgaacatcggccatgcgattatcggc
cgcgcggtgatgagcggcctgaaagaggcggttgctgagatgaagcgcctgatgctggaa
gcgcgcgggtaa

DBGET integrated database retrieval system