KEGG   Enterobacter lignolyticus: Entcl_1357Help
Entry
Entcl_1357        CDS       T01342                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
esc  Enterobacter lignolyticus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:esc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Entcl_1357
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Entcl_1357
   00052 Galactose metabolism
    Entcl_1357
   00500 Starch and sucrose metabolism
    Entcl_1357
   00520 Amino sugar and nucleotide sugar metabolism
    Entcl_1357
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Entcl_1357
   00524 Butirosin and neomycin biosynthesis
    Entcl_1357
Enzymes [BR:esc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Entcl_1357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1430111..1431076
Genome map
AA seq 321 aa AA seqDB search
MTKFALVGDVGGTNARLALCEVATGEISQAKTYSGLDYPSLEAVVQVYLKERNVDVNDGC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGFAHLEIINDFTAVSMAIPMLQKEHLIQFG
GAGPVEGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEGIILEELRAE
LGHVSAERVLSGPGLVNLYRAIVRADGRLPENLQPKDVTERALADSCTDCRRALSLFCAI
MGRFGGNLALTLGTFGGVYIAGGIVPRFLEFFKSSGFRGGFEDKGRFKAYVQDIPVFLIV
HDNPGLLGSGAHLRQTLGHIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagtttgctttagtaggtgacgtcggcggcacaaatgcgcgtctggcgttatgt
gaagtcgcgacgggcgagatttcacaggccaaaacctattctggtcttgattacccgagt
ctcgaggccgtcgttcaggtctacctgaaagagcggaacgtggacgtcaacgacggctgt
atcgccattgcctgcccgattaccggcgactgggtggcgatgacgaaccatacatgggcg
ttttccatcgccgaaatgaagaaaaacctcggctttgcgcatcttgagataatcaacgat
tttaccgccgtctccatggcgataccgatgctgcaaaaagagcatttgattcagttcggc
ggcgccgggccggttgaaggaaaaccgattgccgtctacggcgcgggcacggggctgggc
gttgcccatctggtgcatgtggacaaacgctgggtcagcctgccgggcgagggcggccac
gtcgacttcgcgccgaacagcgaagaagagggcattatcctggaagagctgcgcgccgaa
ctggggcacgtctctgccgagcgggtgctgtccggcccgggtctggttaatctttatcgc
gcaattgtccgagccgacggacgtctgccggaaaatctgcagccaaaagatgtgaccgag
cgcgcgctggccgacagctgcaccgactgtcgccgcgcgttatccctgttctgcgcgatc
atggggcgttttggcggcaacctggcgctgacgctcggcaccttcggcggcgtttatatc
gccggcgggatcgtcccgcgcttcctggagttctttaaatcctcagggtttcgcggcggg
tttgaagataagggtcgctttaaggcctacgtgcaggatatcccggtatttttgatagtc
cacgataatccagggctgctcggttccggcgcgcatctgcgccagacgctgggacacatc
ctctga

DBGET integrated database retrieval system