KEGG   Enterobacter lignolyticus SCF1: Entcl_1493Help
Entry
Entcl_1493        CDS       T01342                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
esc  Enterobacter lignolyticus SCF1
Pathway
esc00071  Fatty acid degradation
esc00072  Synthesis and degradation of ketone bodies
esc00280  Valine, leucine and isoleucine degradation
esc00310  Lysine degradation
esc00362  Benzoate degradation
esc00380  Tryptophan metabolism
esc00620  Pyruvate metabolism
esc00630  Glyoxylate and dicarboxylate metabolism
esc00640  Propanoate metabolism
esc00650  Butanoate metabolism
esc00900  Terpenoid backbone biosynthesis
esc01100  Metabolic pathways
esc01110  Biosynthesis of secondary metabolites
esc01120  Microbial metabolism in diverse environments
esc01130  Biosynthesis of antibiotics
esc01200  Carbon metabolism
esc01212  Fatty acid metabolism
esc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:esc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Entcl_1493
   00630 Glyoxylate and dicarboxylate metabolism
    Entcl_1493
   00640 Propanoate metabolism
    Entcl_1493
   00650 Butanoate metabolism
    Entcl_1493
  Lipid metabolism
   00071 Fatty acid degradation
    Entcl_1493
   00072 Synthesis and degradation of ketone bodies
    Entcl_1493
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Entcl_1493
   00310 Lysine degradation
    Entcl_1493
   00380 Tryptophan metabolism
    Entcl_1493
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Entcl_1493
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Entcl_1493
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Entcl_1493
Enzymes [BR:esc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Entcl_1493
Exosome [BR:esc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Entcl_1493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ADO47754
UniProt: E3GB85
Position
complement(1576495..1577679)
Genome map
AA seq 394 aa AA seqDB search
MKNCVIVSAARTAIGSFNGALATTSAIDLGAIVIKAALERAQLDPQRVDEVIMGNVLQAG
LGQNPARQALLKSGLAETVCGFTVNKVCGSGLKSVALAAQAIQAGQAQALVAGGMENMSQ
APYLLDAKARWGYRLGDGQLSDVILRDGLICATHGYHMGITAENVAREYGISREMQDELA
LLSQRKAVAALDSGAFQAEIVPVSVTSRKKTIVFERDEFPKADSTAEGLAALRPAFDKAG
TVTAGNASGINDGAAALVVMEESAALAAGLKPLARINAYASGGVAPALMGMGPVPATQKA
LQLSGLQLSDIDLIEANEAFAAQFLAVGKTLGFDPLKVNVNGGAIALGHPIGASGARILV
TLLHALSARDKTFGLATLCIGGGQGIAMIVERMN
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaactgtgtcatcgtcagcgcggcacgtaccgcaataggcagctttaacggcgcg
ctggcgaccaccagcgccatcgacctcggcgcaatcgtgattaaggcagcgcttgagcgc
gcacagctcgatccccagcgcgtggatgaagtgatcatgggtaacgtgctgcaggccggt
cttgggcaaaacccggctcgtcaggcgctgctcaaaagcggcctcgcggagacggtctgc
ggctttaccgttaacaaagtgtgcggctccggcctcaaaagcgtagcgcttgccgcgcag
gcgattcaggccgggcaggcgcaggcgcttgtcgccggcggtatggaaaatatgagccag
gcgccctatctgctggatgctaaagcccgttggggctatcgtctcggcgacggacagctg
tctgacgtgattcttcgcgacggccttatctgcgccactcacggctaccatatggggatc
accgcagaaaacgtcgcccgtgagtatggaatcagccgggagatgcaggacgagctggcg
ctactctcacagcgcaaagcggttgccgcccttgattccggcgcattccaggctgaaatt
gtgccggtcagcgtcacatcccgtaagaaaaccatcgtttttgagcgcgacgagtttccc
aaagccgattccacggcggaaggtctggccgcattgcgtccggccttcgataaggccggc
acggtaacggccggaaatgcctcagggatcaatgacggcgcagcggcgctggtggtgatg
gaggaatccgcagcgctggcggcagggctaaaaccgttggcgcggatcaacgcttatgcc
agcggcggcgtggctccggcattgatgggcatggggccggttcctgccacgcagaaggcg
ctgcaactgagcgggttacagctttcggatatcgatctcatcgaagccaacgaggcgttt
gccgcgcagttccttgccgtgggtaagacgctcggtttcgatccgctgaaggtgaacgtc
aacggcggcgctatcgcgctcgggcaccctatcggcgccagcggtgcgcgtattctggtg
acgctgctacacgcgctctccgcgcgggataaaacgttcgggctggccacgctgtgcatc
ggcggcggtcaggggattgcaatgatagtggaaaggatgaattaa

DBGET integrated database retrieval system