KEGG   Enterobacter lignolyticus: Entcl_1648Help
Entry
Entcl_1648        CDS       T01342                                 

Definition
regulatory protein GalF
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
esc  Enterobacter lignolyticus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:esc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Entcl_1648
   00052 Galactose metabolism
    Entcl_1648
   00500 Starch and sucrose metabolism
    Entcl_1648
   00520 Amino sugar and nucleotide sugar metabolism
    Entcl_1648
Enzymes [BR:esc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Entcl_1648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1759399..1760307
Genome map
AA seq 302 aa AA seqDB search
MNMINLKAVIPVAGLGMHLLPATKAIPKEMLPIVDKPMIQYIVDEVVAAGIKEIVLVTHS
SKNAVENHFDTSYELESLLEQRVKRQLLAEVKSICPPGVTIMNVRQAQPLGLGHSILCAR
PIVGDNPFVVALPDIVIDGATADPLRYNLAAMVARFHETGRSQVLAKHMPGDLTEYSVIQ
TKEPLDNEGKVSRIVEFIEKPDQPQTLDSDLMAVGRYVLSGDIWAELERTEPGAWGRIQL
TDAIAELAKKQSVDAMLMTGEAYDCGKKMGYMQAFVQYGLRNLKEGAKFRKSIEKLLSES
RT
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgattaatttgaaagcagttatcccggtagcaggcctggggatgcacttactc
cctgccaccaaggccatcccgaaggagatgctaccgatcgtcgacaagccgatgattcag
tacatcgtcgacgaagtggttgctgcagggatcaaagaaatcgtcctggttactcactct
tccaaaaacgcggttgagaaccacttcgacacctcatatgaacttgaatctctgctggag
cagcgcgtaaaacgccagctgcttgctgaagtaaagtctatctgcccgccgggcgtgacg
attatgaacgttcgccaggcgcaacccctggggctggggcactctattctgtgcgcgcgt
ccgatcgtcggggataacccgttcgtggtggcgctgccggatatcgttatcgacggcgcg
accgccgacccgctgcgctataacctggcggccatggtggcgcgtttccacgaaaccggc
cgcagccaggtgctggcgaagcatatgccgggagacctgaccgaatactcggttatccag
accaaagagccgctggataatgaagggaaagtgagccgtatcgtcgagtttatcgaaaaa
ccggaccagccgcagacgctggattccgacctgatggcggtgggccgctacgtgctctcc
ggcgatatctgggcagagcttgagcgcaccgaaccgggcgcctggggccgcattcagctg
accgacgcgattgccgagctggcgaaaaagcagtccgttgatgcgatgctgatgaccggc
gaagcgtacgactgcggtaagaagatgggctacatgcaggccttcgtgcagtatgggtta
cgcaacctgaaggaaggcgcgaagttcaggaagagcatcgaaaagctgttgtctgagtcg
cggacataa

DBGET integrated database retrieval system