KEGG   Enterobacter cloacae SCF1: Entcl_1652Help
Entry
Entcl_1652        CDS       T01342                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
esc  Enterobacter cloacae SCF1
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:esc00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:esc00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1763572..1764126
Genome map
AA seq 184 aa AA seqDB search
MKVINTQLEEVKIIEPTVFGDDRGFFMETWNQKKFEELVTNGVSTKFVQDNHSKSKKGIL
RGLHFQSENTQGKLVRVGVGAVFDVAVDVRKNSPTLGKWVGVELSAENKRQLWVPEGFAH
GFYVLSDTAEFIYKCTDFYNPKAEHSIIWNDPAIGVDWPLDETVPLILSEKDMNGVTLKM
FLEL
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaattaatacgcagcttgaagaagtcaaaattattgaacccaccgtttttggt
gatgatcgcgggttctttatggagacctggaaccagaaaaaatttgaagaactggtgact
aatggtgtttccacaaaatttgtacaagataatcattcaaagtctaagaaaggaatctta
cgtgggttacattttcaaagcgaaaatacccaaggtaagcttgtccgtgtcggtgttggt
gccgtatttgatgtggccgttgacgtccgtaaaaactcacctacattaggtaaatgggtg
ggggttgagctatcggctgaaaacaaaagacagttgtgggttcctgaaggatttgctcac
ggtttttatgtattaagcgatacagcagagtttatttataagtgcacagatttttataat
cctaaagctgaacattccatcatttggaatgaccctgctatcggagttgattggccgctt
gatgaaacagtacctttgatactgtctgaaaaagacatgaatggtgttacattaaagatg
tttttagaattataa

DBGET integrated database retrieval system