KEGG   Enterobacter lignolyticus: Entcl_1673Help
Entry
Entcl_1673        CDS       T01342                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
esc  Enterobacter lignolyticus
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:esc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Entcl_1673
  Amino acid metabolism
   00340 Histidine metabolism
    Entcl_1673
Enzymes [BR:esc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Entcl_1673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1786679..1787983)
Genome map
AA seq 434 aa AA seqDB search
MSFNTVIDWNTCSPQQQRALLLRPAIGASESISRTVSDILDNVRARGDAALREYSAKFDK
TEVGALKVTAQEIDDASARLSPALKQAMAVAVKNIETFHTAQQLPGVDVETQPGVRCQQV
TRPVASVGLYIPGGSAPLFSTVLMLATPARIAGCRQVVLCSPPPIADEILYAARLCGVQD
VYKAGGAQAIAAMAFGSESVPKVDKIFGPGNAFVTEAKRQVSQRLDGAAIDMPAGPSEVL
VIADSGATPDFVASDLLSQAEHGPDSQVILLTPDAQMAARVAEAVERQLAELPRADTARQ
ALSASRLIVARDIGQCISISNQYGPEHLIIQTRNARELVERITNAGSVFLGDWSPESAGD
YASGTNHVLPTYGYTATCSSLGLADFQKRMTVQELSRDGFASLAATIETLATAERLTAHK
NAVTLRVAALKEQA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagctttaataccgtaatcgactggaacacctgtagcccccagcagcagcgcgcgctg
ctgctgcgcccggccattggtgcctcagagagcatcagccgcaccgtgagcgacatcctc
gacaacgttcgcgcccgcggcgatgcagcgctgcgcgagtacagcgcgaagttcgataaa
accgaggtcggcgcgctgaaggttaccgcgcaggagatagacgacgccagcgcgcgcctg
agcccggcgctgaagcaggcgatggccgtcgcggtgaaaaacattgaaaccttccacacc
gcgcaacagctgccgggcgtggacgtagagacccagcccggcgtgcgctgccagcaggtc
acccgtccggtcgcatccgtcgggctgtatattccaggcggttcggctccgctcttttcc
accgtgctgatgctggcgacgcccgcccgcatcgccggctgccggcaggtggtgctgtgc
tcgccgccgccgatcgccgacgaaattctctatgccgcccgcctgtgcggcgtgcaggac
gtgtataaggctggcggcgcgcaggcgattgccgcgatggcgttcggcagcgaatcggtg
ccgaaggtcgacaaaattttcgggccgggcaacgccttcgtcaccgaagcgaagcgccag
gtcagccagcgtcttgacggcgcggcgatcgacatgcccgcaggcccgtcggaggtgctg
gtgatcgccgacagcggcgcaacgccggatttcgtcgcctcggacctgctctcgcaggcg
gagcacggcccggactcacaggtgatcctgctgacgccggatgcgcagatggccgcccgc
gtcgccgaggccgtcgagcgccagctcgccgaactgccgcgcgccgataccgcccgccag
gcactctcggcaagccgcctgattgtcgcccgcgatatcgggcagtgcatcagcatctcc
aaccagtacgggccggagcacctgattatccagacgcgtaacgcccgggagctggtcgaa
cgcatcaccaacgccggttcggtgtttcttggcgactggtcgccggaatccgctggcgat
tacgcctccggcaccaaccatgtgctgccgacctacggctataccgcaacctgctcaagc
ctcgggcttgccgatttccagaagcggatgacggtacaggagctgtcccgcgacggtttc
gcgtcgctggcggctaccattgaaacgctggctacggccgaacgtctgactgcccacaaa
aacgccgttacgctgcgcgttgcagcccttaaggagcaagcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system