KEGG   Enterobacter cloacae SCF1: Entcl_1781Help
Entry
Entcl_1781        CDS       T01342                                 

Definition
phosphoglycerate mutase
Orthology
K02226  
alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
esc  Enterobacter cloacae SCF1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:esc00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1903169..1903777
Genome map
AA seq 202 aa AA seqDB search
MRFFLVRHGQTTANVSGVFYGSTDLSLSPQGIGQSRRVAGYLSGVSFGRTIVSQLQRSQQ
TARLVVPAGAELHVDSRLNELDFGEWEMRHFSDIEKESPASWQRWMDDWQNATPDGGEAF
SHFAARVRQAADETGKQRENTDTLIVAHQGVLSLMLATWLGMPVEAMWHFPFGHDAYTVV
DNQAGFWVLRVFNGRSVWQTEE
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttttttctggttcggcacggtcagacaacggccaacgtcagcggcgtattttac
ggcagcaccgatttatcgctatcgccacaggggattggacaaagccggcgcgtcgccggg
tatctgtctggggtctcctttggacggacgatagtcagccagctgcagcgctcgcagcaa
acggcgcggctggtcgttccggcgggggcggagctgcatgttgattcgcgcctcaatgag
ctggattttggcgaatgggaaatgcggcatttcagcgacatcgaaaaagagagccccgcg
tcgtggcagcgctggatggatgactggcaaaacgccacgccggacggcggcgaggccttc
tcgcactttgccgcgcgcgtcaggcaggctgcggatgagacaggtaaacagcgggagaat
acagacacgctgattgtggcgcatcagggcgtgttgagcctgatgctggcgacctggcta
gggatgcccgtggaggcgatgtggcatttccctttcgggcacgatgcctacacggtcgtt
gataatcaggccggattttgggtgttgcgcgtatttaatggcagaagcgtttggcaaact
gaagagtga

DBGET integrated database retrieval system