KEGG   Enterobacter lignolyticus: Entcl_1781Help
Entry
Entcl_1781        CDS       T01342                                 

Definition
phosphoglycerate mutase
Orthology
K02226  
alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
esc  Enterobacter lignolyticus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Module
Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:esc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Entcl_1781
Enzymes [BR:esc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     Entcl_1781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1903169..1903777
Genome map
AA seq 202 aa AA seqDB search
MRFFLVRHGQTTANVSGVFYGSTDLSLSPQGIGQSRRVAGYLSGVSFGRTIVSQLQRSQQ
TARLVVPAGAELHVDSRLNELDFGEWEMRHFSDIEKESPASWQRWMDDWQNATPDGGEAF
SHFAARVRQAADETGKQRENTDTLIVAHQGVLSLMLATWLGMPVEAMWHFPFGHDAYTVV
DNQAGFWVLRVFNGRSVWQTEE
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttttttctggttcggcacggtcagacaacggccaacgtcagcggcgtattttac
ggcagcaccgatttatcgctatcgccacaggggattggacaaagccggcgcgtcgccggg
tatctgtctggggtctcctttggacggacgatagtcagccagctgcagcgctcgcagcaa
acggcgcggctggtcgttccggcgggggcggagctgcatgttgattcgcgcctcaatgag
ctggattttggcgaatgggaaatgcggcatttcagcgacatcgaaaaagagagccccgcg
tcgtggcagcgctggatggatgactggcaaaacgccacgccggacggcggcgaggccttc
tcgcactttgccgcgcgcgtcaggcaggctgcggatgagacaggtaaacagcgggagaat
acagacacgctgattgtggcgcatcagggcgtgttgagcctgatgctggcgacctggcta
gggatgcccgtggaggcgatgtggcatttccctttcgggcacgatgcctacacggtcgtt
gataatcaggccggattttgggtgttgcgcgtatttaatggcagaagcgtttggcaaact
gaagagtga

DBGET integrated database retrieval system