KEGG   Enterobacter cloacae SCF1: Entcl_1822Help
Entry
Entcl_1822        CDS       T01342                                 

Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
esc  Enterobacter cloacae SCF1
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:esc00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1944670..1945656
Genome map
AA seq 328 aa AA seqDB search
MSLQNLTRFPRLEFIGAPTPLEYLPRLSDHLGRDIFIKRDDVTPMAMGGNKLRKLEFLAA
DALREGADTLITAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTRAENYLSNGNRLLLD
LLNAQVEMCDALSDPNRQLEELATRLEAQGFRPYAIPVGGSNALGALGYVESALEIAQQC
EGAVALSSVVVASGSAGTHAGLAVGLEQLMPDVELIGVTVSRKVAEQKPKVVTLQQAVAE
SLGLQAKADIVLWDDYFAPGYGTPNEEGMEAVKLLARLEGILLDPVYTGKAMAGLIDGIS
QKRFKDEGPVLFVHTGGAPALFAYHPHV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgcaaaatctcacccgctttcctcgtcttgaatttattggcgccccgacgccg
ctggagtacctgccgcgcctgtccgaccatcttggccgcgatatttttatcaaacgtgac
gacgtcacgccgatggcgatgggcggcaataagctgcgcaaactggagttcctggccgcg
gacgcgctgcgcgaaggcgccgatacgctgatcaccgcgggcgctatccagtccaaccac
gtgcgccagacggcggcggtggcggcaaagctggggctgcactgcgtcgcgttactggaa
aaccccataggcacccgggcggaaaactatctcagcaacggcaatcgcctgctgctcgac
ctgctgaatgcccaggtggaaatgtgcgacgcgttgagcgatccgaaccgtcagctggaa
gaactggcgacccgccttgaagcgcagggttttcgcccgtacgcgatcccggtcggcggc
tccaacgcgctcggcgcgctgggctatgtggaaagcgcgctggaaattgcccagcagtgc
gaaggggcggtagcgctctcgtccgtcgtggtggcttccggcagcgcggggacgcatgcg
gggctggcggtagggctggagcagctgatgccggacgtcgagcttatcggcgtgacggtg
tcgcgtaaggtcgcagaacaaaagccgaaagtggtcacgctgcagcaggcggtcgcggaa
agccttgggctacaggcaaaagcggacatcgtcctgtgggatgactattttgccccgggc
tacggcacgccgaatgaagagggcatggaggcggtgaagctgctggcgcgtcttgagggc
atcctgctcgatccggtatacaccggaaaggcgatggccggccttatcgacggcatcagc
cagaagcgctttaaggatgaggggcctgtcctgttcgttcataccggcggggcgccagcg
ctgttcgcctatcatcctcacgtctga

DBGET integrated database retrieval system