KEGG   Enterobacter lignolyticus: Entcl_1910Help
Entry
Entcl_1910        CDS       T01342                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
esc  Enterobacter lignolyticus
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:esc00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Entcl_1910
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Entcl_1910
Enzymes [BR:esc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Entcl_1910
Two-component system [BR:esc02022]
 CheA family
  CheA-CheYBV
   Entcl_1910
Bacterial motility proteins [BR:esc02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Entcl_1910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2020821..2021870
Genome map
AA seq 349 aa AA seqDB search
MSKIRVLSVDDSALMRQIMTEIINSHSDMEMVATAPDPLVARDLIKKFNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKGSEVTLRALELGAIDFVTKPQIGIREGMLAYS
EMIADKVRAASRARLSAHKPLTAPVALKAGPMLSSEKLLAIGASTGGTEAIRHVLQPLPL
TSPAILITQHMPPGFTRSFAERLNKLCQITVKEAEDGERVLPGHAYIAPGDKHMELARSG
ANYQIKIHDGPPVNRHRPSVDVLFHSVAKNAGRNAVGVILTGMGNDGAAGMLAMHQAGAW
TIAQNEASCVVFGMPREAINMGGVSEVVDLSQVSQQMLAKISAGQAIRI
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatcagggtgttgtctgtcgatgactccgcattgatgcggcagattatgacg
gaaatcatcaacagccacagcgatatggagatggtcgccacggcgcccgatccgctagtc
gcccgggatcttattaaaaaattcaacccggacgtgctgacgctggatgtcgaaatgccg
cggatggacggtctcgattttctcgaaaaattgatgcgcctgcggccgatgccagtcgtg
atggtgtcgtcgctgaccggtaaaggttccgaagtgacgctgcgcgcgctggagcttggc
gccatcgacttcgtgacaaaaccgcaaatcggcattcgagaagggatgctggcctacagc
gaaatgattgccgacaaggttcgcgccgcgtcaagggctcgtctgagcgcccataagccg
ctgacggcgccggtggcgctgaaagccgggccgatgctgagctcggaaaagctgctggcg
attggcgcctcaaccggcggcaccgaggcgattcgccacgtgctgcagccgctgccgctg
accagcccggcgatcctcatcacccagcatatgccgccagggtttacccgctcttttgcg
gaacgtctgaacaagctgtgccagataacggtgaaagaggcggaggacggcgagcgcgtg
ctgccgggccatgcctatatcgcccccggggataagcatatggagctggcgcgaagcggc
gccaactaccagatcaaaattcatgacggcccgccggtcaaccggcaccgtccgtcggtc
gacgtgctgtttcactcggtcgccaaaaatgcgggacgcaacgccgttggggtgatcctt
accgggatgggcaacgacggcgcggcgggaatgctggcaatgcaccaggcgggcgcctgg
accattgcgcaaaacgaagcaagttgtgtggtgttcggcatgccgcgtgaggccatcaat
atgggtggcgtcagcgaagtggtcgatcttagccaggtaagccagcagatgctggcgaaa
atcagtgccggacaggcaatacgtatttaa

DBGET integrated database retrieval system