KEGG   Enterobacter lignolyticus: Entcl_1929Help
Entry
Entcl_1929        CDS       T01342                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
esc  Enterobacter lignolyticus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:esc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Entcl_1929
Enzymes [BR:esc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Entcl_1929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2039677..2040288
Genome map
AA seq 203 aa AA seqDB search
MIGRLRGIILEKQPPLVLLEAGGVGYEVHMPMTCFYELPDQGKEAIIFTHFVVREDAQLL
FGFNNKQERTLFRELIKTNGVGPKLALAILSGMSAAQFVNAVEREDPAALVKLPGIGKKT
AERLIVEMKDRFKGLHGDLFTPAADLVLTSPASPAADDAEQEAVAALVALGYKPQEASRM
ISKIARPDANSETLIREALRAAL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgatcggcagactcagaggcattattctggaaaaacaacccccgctggtactgttagag
gcgggcggcgtcggctacgaagtccatatgccaatgacctgtttctacgaactgccggac
caggggaaagaggctattattttcacccattttgtggtgcgcgaggacgcccagctgctg
tttggcttcaataacaagcaggagcgcacgctgttccgcgagcttatcaagaccaacggc
gtggggccgaagctggcgctggcgattctttccggtatgtccgcggcgcagttcgttaac
gcggttgaacgcgaagatccggcggcgctggtgaaactgccgggcatcggcaagaaaacc
gcagagcgcctgattgtcgagatgaaggaccgcttcaaaggcctgcacggcgatctgttc
actccggccgccgacctggtgctgacctctccggcgagcccggcggcggatgatgccgag
caggaagcggttgccgcgctggtggcgctgggctataaaccacaggaagccagccggatg
ataagcaaaatcgcccgtccggacgccaacagtgaaacgctaattcgcgaagcgcttcgc
gccgcattgtga

DBGET integrated database retrieval system