KEGG   Enterobacter lignolyticus SCF1: Entcl_2043Help
Entry
Entcl_2043        CDS       T01342                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
esc  Enterobacter lignolyticus SCF1
Pathway
esc00900  Terpenoid backbone biosynthesis
esc01100  Metabolic pathways
esc01110  Biosynthesis of secondary metabolites
esc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:esc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Entcl_2043
Enzymes [BR:esc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Entcl_2043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ADO48297
UniProt: E3G549
Position
complement(2160645..2161514)
Genome map
AA seq 289 aa AA seqDB search
MSTRWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTITIDLRQDGQLRLLTPVDGV
PEDENLIVRAARLLMRAAAESGRLPANAGADIGIEKRLPMGGGLGGGSSNAATVLVALNH
LWQCGLSVDELATLGLTLGADVPVFVRGHAAFAEGVGEVLTPVDVPEKWYLVAHPGVSIP
TPVIFKDPDLPRNTSVRSIETLLKCEFSNDCEVIARKRFREVDAALSWLLEYAPSRLTGT
GACVFAEFDTESAARQVLEQAPEWLHGFVAQGVNLSPLKQAMTGQAELR
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgagcacccgttggccctccccggcaaagctgaatctgtttttgtacatcaccggccag
cgcgccgatggttatcacaccctgcagacgctgtttcagtttcttgactacggcgacacg
ataaccatcgacctgcgccaggacggccagctgcgcctgctgacgcccgtcgacggcgtg
ccggaggatgagaacctgatcgttcgcgccgcccgtctgctgatgcgcgcggcggcagag
agcggacggcttccggccaacgccggcgcggatatcggtatcgaaaagcgcctgccgatg
ggtggcggtcttggcggcggctcctccaatgcggcgaccgtactggtcgcgctgaaccac
ctgtggcaatgcgggctgtcggttgacgaactggcgacccttggcctgaccctcggcgcg
gacgtgccggtattcgtccgcggacacgccgcctttgccgaaggcgtcggcgaagtactg
acgccggtcgacgttccggagaaatggtatctggtggcgcaccctggcgtcagcattccg
acgccggtgatttttaaggatccggacctgccgcgcaacacatcggtgcggtcaatagaa
acgttactaaaatgtgaattcagcaacgattgcgaggttatcgcaagaaaacgttttcgc
gaggttgatgcggcgctttcctggctgttagaatacgcgccgtcgcgcctgactggcaca
ggggcctgtgtctttgctgaatttgacaccgaatccgccgctcgtcaggtgctagagcaa
gccccggaatggctgcatggttttgtagcgcaaggtgtaaacctctcgccgcttaagcaa
gccatgaccgggcaagctgagctccggtga

DBGET integrated database retrieval system