KEGG   Enterobacter lignolyticus SCF1: Entcl_2069Help
Entry
Entcl_2069        CDS       T01342                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
esc  Enterobacter lignolyticus SCF1
Pathway
esc00040  Pentose and glucuronate interconversions
esc00052  Galactose metabolism
esc00500  Starch and sucrose metabolism
esc00520  Amino sugar and nucleotide sugar metabolism
esc01100  Metabolic pathways
esc01130  Biosynthesis of antibiotics
Module
esc_M00362  Nucleotide sugar biosynthesis, prokaryotes
esc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:esc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Entcl_2069
   00052 Galactose metabolism
    Entcl_2069
   00500 Starch and sucrose metabolism
    Entcl_2069
   00520 Amino sugar and nucleotide sugar metabolism
    Entcl_2069
Enzymes [BR:esc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Entcl_2069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ADO48323
UniProt: E3G575
Position
2189944..2190852
Genome map
AA seq 302 aa AA seqDB search
MAALNSKVTKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLEEVQSICPPHVTIMQVRQGLAKGLGHAVL
CAHPVVGDEAVAVILPDVILDEYESDLSRDNLAEMIRRFDETGASQIMVEPVEDVTAYGV
VDCKGEALHPGDSVPMVGVVEKPKADVAPSNLAVVGRYVLSAEIWPLLAKTPPGAGDEIQ
LTDAIDMLIEKETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNTLGADFKAWLEETMGV
SK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggctgcattaaattcaaaagtcactaaggccgtaatcccggttgcgggattagggacc
cggatgttacccgccaccaaagctattcctaaggaaatgctgccgctggtggataagcca
ttaattcagtatgttgttaatgaatgtatcgcagcaggcatcactgaaattgtgcttgtt
acccattcttcaaaaaattcaattgaaaaccactttgataccagctttgaactcgaagcg
atgctggaaaaacgcgtaaagcgccagctgctggaagaagttcagtctatttgcccgccg
cacgtcactattatgcaggtgcgtcagggactggcgaaaggtctgggacatgcggtgctg
tgcgcgcatccggttgtgggcgatgaagcggttgccgtcatcctgccggacgttattctg
gacgaatatgagtccgacctgtcccgcgataacctggcggaaatgatcaggcgctttgat
gagaccggcgccagccagatcatggttgaacccgttgaagacgttaccgcatacggcgtg
gtggactgcaagggcgaagcgctgcatccgggcgacagcgtgccgatggttggcgtagtg
gaaaaaccgaaagccgacgttgcgccgtcgaatctggccgtcgtagggcgctatgtgctc
agcgctgaaatctggcctctgctggcgaaaacccctccgggagccggtgacgaaattcag
ctgactgacgccattgatatgctgatcgaaaaagagacggttgaagcgtaccacatgaag
ggcaagagccacgactgcggtaataagcttggctatatgcaggcattcgtcgaatacggt
attcgccacaataccctgggcgctgattttaaagcgtggctggaagagacgatgggcgtg
agcaagtaa

DBGET integrated database retrieval system