KEGG   Enterobacter lignolyticus: Entcl_2069Help
Entry
Entcl_2069        CDS       T01342                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
esc  Enterobacter lignolyticus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:esc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Entcl_2069
   00052 Galactose metabolism
    Entcl_2069
   00500 Starch and sucrose metabolism
    Entcl_2069
   00520 Amino sugar and nucleotide sugar metabolism
    Entcl_2069
Enzymes [BR:esc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Entcl_2069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2189944..2190852
Genome map
AA seq 302 aa AA seqDB search
MAALNSKVTKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLEEVQSICPPHVTIMQVRQGLAKGLGHAVL
CAHPVVGDEAVAVILPDVILDEYESDLSRDNLAEMIRRFDETGASQIMVEPVEDVTAYGV
VDCKGEALHPGDSVPMVGVVEKPKADVAPSNLAVVGRYVLSAEIWPLLAKTPPGAGDEIQ
LTDAIDMLIEKETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNTLGADFKAWLEETMGV
SK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggctgcattaaattcaaaagtcactaaggccgtaatcccggttgcgggattagggacc
cggatgttacccgccaccaaagctattcctaaggaaatgctgccgctggtggataagcca
ttaattcagtatgttgttaatgaatgtatcgcagcaggcatcactgaaattgtgcttgtt
acccattcttcaaaaaattcaattgaaaaccactttgataccagctttgaactcgaagcg
atgctggaaaaacgcgtaaagcgccagctgctggaagaagttcagtctatttgcccgccg
cacgtcactattatgcaggtgcgtcagggactggcgaaaggtctgggacatgcggtgctg
tgcgcgcatccggttgtgggcgatgaagcggttgccgtcatcctgccggacgttattctg
gacgaatatgagtccgacctgtcccgcgataacctggcggaaatgatcaggcgctttgat
gagaccggcgccagccagatcatggttgaacccgttgaagacgttaccgcatacggcgtg
gtggactgcaagggcgaagcgctgcatccgggcgacagcgtgccgatggttggcgtagtg
gaaaaaccgaaagccgacgttgcgccgtcgaatctggccgtcgtagggcgctatgtgctc
agcgctgaaatctggcctctgctggcgaaaacccctccgggagccggtgacgaaattcag
ctgactgacgccattgatatgctgatcgaaaaagagacggttgaagcgtaccacatgaag
ggcaagagccacgactgcggtaataagcttggctatatgcaggcattcgtcgaatacggt
attcgccacaataccctgggcgctgattttaaagcgtggctggaagagacgatgggcgtg
agcaagtaa

DBGET integrated database retrieval system